GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:35:05

Sequence HS6ST3_1 : 3204 bp : 43.66% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1203   1899  697  0  1  119   69   900 0.601  82.69
tacatacgtctttatggaaacatatgcacatgcatcaatagacacaaatgcaggcgaata
ctctcacatgaacatttggcaaagagtcccttgactcaatgccgatgtaaaattataaaa
atttagatacctcctgttagagttgtcaactactgatgctcttcctctaatttcttctag
GAATTTCTATTACATCACAATGTTACGGGATCCAGTGTCACGTTACCTGAGCGAGTGGAA
ACATGTCCAGAGAGGGGCCACTTGGAAAACCTCTCTTCATATGTGTGATGGAAGAAGCCC
CACCCCAGATGAGCTGCCTACCTGCTACCCTGGGGATGACTGGTCTGGGGTCAGCTTGCG
GGAGTTTATGGATTGCACCTACAACCTGGCTAACAATCGCCAGGTGCGCATGCTGGCTGA
CCTCAGCCTGGTGGGCTGCTATAACTTGACTTTCATGAACGAGAGTGAAAGAAACACCAT
CCTGTTGCAGAGTGCAAAGAACAACCTGAAGAACATGGCCTTCTTTGGGCTCACTGAGTT
CCAGAGGAAGACACAGTTTCTCTTTGAGAGAACATTCAACCTCAAGTTCATCTCCCCCTT
CACACAGTTCAACATCACGCGGGCTTCTAACGTGGAGATCAACGAGGGTGCCCGCCAACG
CATTGAGGATCTAAACTTCCTGGACATGCAGCTTTACGAGTATGCAAAAGATCTCTTCCA
GCAGCGCTACCACCACACCAAGCAGCTAGAGCACCAGAGGGACCGCCAGAAGCGGCGGGA
GGAGCGGAGGCTGCAGCGAGAGCACAGGGACCACCAGTGGCCCAAAGAAGATGGGGCTGC
AGAAGGGACTGTCACCGAGGACTACAACAGCCAGGTG
gtgagatggtgacctcctgccctctcctctctcaggagggggagggtgagcaggcacatt
gactttctgttgaggtaccttggagaagctgagccattctgaggacatctggctgtgtgt
gcttgatttggacatcttcttccttctttgtcttcatttttatccagctggagattatcc

Predicted peptide sequence(s):


>HS6ST3_1|GENSCAN_predicted_peptide_1|233_aa
XNFYYITMLRDPVSRYLSEWKHVQRGATWKTSLHMCDGRSPTPDELPTCYPGDDWSGVSL
REFMDCTYNLANNRQVRMLADLSLVGCYNLTFMNESERNTILLQSAKNNLKNMAFFGLTE
FQRKTQFLFERTFNLKFISPFTQFNITRASNVEINEGARQRIEDLNFLDMQLYEYAKDLF
QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQV