GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:53:06

Sequence FGF9_1 : 32712 bp : 43.36% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1391   1654  264  0  0   63   74   127 0.717   6.28
gattacttttatttatgcatttaatggattgaagaaaagaaccttttttttctctctctc
tctgcaactgcagtaagggaggggagttggatatacctcgcctaatatctcctgggttga
caccatcattattgtttattcttgtgctccaaaagccgagtcctctgatggctcccttag
GTGAAGTTGGGAACTATTTCGGTGTGCAGGATGCGGTACCGTTTGGGAATGTGCCCGTGT
TGCCGGTGGACAGCCCGGTTTTGTTAAGTGACCACCTGGGTCAGTCCGAAGCAGGGGGGC
TCCCCAGGGGACCCGCAGTCACGGACTTGGATCATTTAAAGGGGATTCTCAGGCGGAGGC
AGCTATACTGCAGGACTGGATTTCACTTAGAAATCTTCCCCAATGGTACTATCCAGGGAA
CCAGGAAAGACCACAGCCGATTTG
gtaggtataccattaaccctttagtgtccatgagatgacatgttgaaattataactacca
agaaggtggtggccgggtgggggacgtgggaagggttctcccctcctcccctctttctct
gtatctctgtctctctctctctctgtcttgccagctccgaaaaaaaaatgcctccggaat

 1.02 Intr +   2757   2822   66  1  0   60  100    72 0.345   4.48
cacagtcccaattgggtggactcttgagttttttccttacttaaaaaaaaaaaaataagc
gccagtttgggcaactagactgttggaaggagttaacttctgagtgaacccacctgacaa
cacttaaactaggtcgtaaaaaacaaagtcctctggtgatttttcttcctcatgctttag
TGCCAGATGTTGAACACAATCTAAACTGTATGTTTAGCTTCGTGCGGCTGCGGATGATGC
CAGAAG
gtgaggaggacttaggcctgggctggggatggtcccagatccacgaggcccaggatttgc
tcctcatgctcacccctgagcctaagcccacagctgagcctagtagtgtgaaattgctcc
ggccgtctccactcgctgcttaaaaaaaagttatagctctttgctttgcaattattcagt

 1.03 Intr +  10507  10610  104  2  2  100   89   122 0.945  13.39
gttgaaaatcaattcttttacacagtgattttcaaagagaagacacttctttaactagcg
tggggttatccaagtggggagctgggcttagtgtcctctccaaaaccccagggatgctgg
gactctaaggacatgctctgtgatctgatctgtcctctgccttctaccctttgtctacag
GCATTCTGGAATTTATCAGTATAGCAGTGGGCCTGGTCAGCATTCGAGGCGTGGACAGTG
GACTCTACCTCGGGATGAATGAGAAGGGGGAGCTGTATGGATCA
gtaagtactggagggacttcatccagctttatctccatgtttgatttgaacagctgtctt
ttctctggattaaaaagggccagaaatgcaactgagtctgtttggaaggcgagtgtaagt
ttttactttttgaggaaagccattttatttttattaatagataaacagctctgcaccttc

 1.04 Intr +  19443  19502   60  2  0  104   61    36 0.506   1.43
tggagaagtctgatcagcttgtaagttagggtctgcaaggataaccaggtgacagtggct
tcagggacaacagaggcccaagcccagcgtctccaagctcttcctgcttcttccacctcc
tggcctcctaaatcctggcattccttcctctcacctctcccacatcacccctgttttcag
AATGGATTGTTCATTGCATGGAACCCTGGAGAACCCCTCAACCAGAGCCTCAGTGTCATG

gtcagttcctgaattgcagagcttcctacttctctccagggtagcgtagtctctctgggt
tccctgagttaatactgctgcacagcctgattcagaatagggctcaaattggaagctctc
tgtaatcagtcacacattcgcacactcgctcacacactcacacactcttccatccacaca

 1.05 Term +  30655  30900  246  0  0  136   48    70 0.778   3.59
tttaaaaaattttaattttaatttttagttctggggtacatgtgtaggatgcgcaggttt
gttaaatagataaacgtgtgccaaggtggtttgctgcacctatcaatccatcccctaggt
attaagcccagcatgcattagctatttttcctaatgctctccctctttttctttttacag
GAAAAACTAACCCAAGAGTGTGTATTCAGAGAACAGTTCGAAGAAAACTGGTATAATACG
TACTCATCAAACCTATATAAGCACGTGGACACTGGAAGGCGATACTATGTTGCATTAAAT
AAAGATGGGACCCCGAGAGAAGGGACTAGGACTAAACGGCACCAGAAATTCACACATTTT
TTACCTAGACCAGTGGACCCCGACAAAGTACCTGAACTGTATAAGGATATTCTAAGCCAA
AGTTGA
caaagacagtttcttcacttgagcccttaaaaaagtaaccactataaaggtttcacgcgg
tgggttcttattgattcgctgtgtcatcacatcagctccactgttgccaaactttgtcgc
atgcataatgtatgatggaggcttggatgggaatatgctgattttgttctgcacttaaag

Predicted peptide sequence(s):


>FGF9_1|GENSCAN_predicted_peptide_1|246_aa
XEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRR
QLYCRTGFHLEIFPNGTIQGTRKDHSRFVPDVEHNLNCMFSFVRLRMMPEGILEFISIAV
GLVSIRGVDSGLYLGMNEKGELYGSNGLFIAWNPGEPLNQSLSVMEKLTQECVFREQFEE
NWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYK
DILSQS