GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:41:17

Sequence FGF14_1 : 196360 bp : 36.38% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1393  193  0  1  125   66   249 0.590  25.58
ggagagggcgatgggtcccggtcaggactgagccccccttcccctctccccagtcccgcc
tggcaccccctcctctgccccgagggcgagccacggtctgcgccgccgccttcccctccg
gtgcccccggctcgccgtcctcccgcgccctccctccccggacccgttcccggggccacc
ATGGCCGCGGCCATCGCTAGCGGCTTGATCCGCCAGAAGCGGCAGGCGCGGGAGCAGCAC
TGGGACCGGCCGTCTGCCAGCAGGAGGCGGAGCAGCCCCAGCAAGAACCGCGGGCTCTGC
AACGGCAACCTGGTGGATATCTTCTCCAAAGTGCGCATCTTCGGCCTCAAGAAGCGCAGG
TTGCGGCGCCAAG
gtctgtgggggtcatggtcgggagatgcgccccgggtcgccccctccccgcctaaacgga
gcttctccaggctccttccctccctcggttttcccggcccaccccggccccggcctccct
tctgagcactctgggtgccgtcgcggggaccctggagtccgctgtcgggcaacctgtagc

 1.02 Term +   1842   1933   92  1  2   81   43    67 0.576  -1.60
ggaaacctgttccccctgagtctcggcttcccgggaggatagggactggcactggctctg
gaacgcggggcaccccttcctgccacacccggggtcgagccaccgctcgcagtctgatct
gagctggtgggggtttccatggggtgggcctggcctcacttggtctctggggtctcctag
AAACCTCCCGGGTTCCCAGACCTTGGACAAATGTGGATATCCTGGCGGTGCCCCCAGCGG
GAGCTGCTGTAGAAGGAGTGGAGGGTGTGTGA
actatggcccagtccgctgaggttcagcagaaggctgcttagcgcgcagccctgggctct
gcagcccttcagtcaaatcctgggatggggacagaggctcagggagtctaaagaaagaat
ccgaattgcggggagcggggggcagaagtaaaaatccctaatatgtgtcagttttaattg

 2.02 PlyA -   3446   3441    6                               1.05
 2.01 Sngl -   9194   8247  948  2  0   75   44   276 0.807  18.23
 2.00 Prom -  12616  12577   40                              -3.25

 3.01 Init +  39826  39853   28  0  1   89   75    18 0.352   0.42
ggatagatgtgggaaattatggaatatttataggtaacccacagtgacccaggtgaggct
acttgcaggggatggataagggctatagtgagcagagccatcagataagatagggcctta
ctgcggtaaggtgcatacgtaactcagtggatggtgaagagtcactgcatatttccagac
ATGAAGGATTTGAAAAGGAAAACTGCAG
gtgggaagaccacctaagagaggtaatgaggggctggcagtgaaaatagaaaaaaagaaa
aagagcgagagatgcggaagatgcatcaaaaggaattgagcaacccatttgttttaaact
tatagtactgaactagcaattttggtaaggttttaatggggcagagatgtattggaaatg

 3.02 Intr +  42550  42660  111  2  0   95   94    88 0.280   9.53
tttaccttctataaatagaatactgcaggtttgataaaacacagaagaatctgagagaca
aaataaaatatgctacttgtataaaatgtcctcttctgaaaaaagaaagagaaacagaaa
agataaaggaaactatggtgacacattgtgaggcttatgataactatgtttgcctttcag
ATCCCCAGCTCAAGGGTATAGTGACCAGGTTATATTGCAGGCAAGGCTACTACTTGCAAA
TGCACCCCGATGGAGCTCTCGATGGAACCAAGGATGACAGCACTAATTCTA
gtaagtgacaacctcaggccaccagttacatagttggtagaagatacactgctacttaaa
tgactttttaagattcatttgcaaatgtttggtcgtgttggttcatctttacaaatgtta
cacactaggatgccatttacaattttatttaaactacgtggatgaaaatattaatggagt

 3.03 Intr +  49018  49121  104  2  2   82   89    60 0.321   4.47
tcattttacccatagcagaaacttcttacttataaagcaaaatataagttatttaattgg
aatttctagaaagtattggcaaagatgatgtttcttaaataaaataaatcagaaagaaaa
aattacactctgccctgcttcttcctgcccattcatgatagacaatgtttatcttcacag
CACTCTTCAACCTCATACCAGTGGGACTACGTGTTGTTGCCATCCAGGGAGTGAAAACAG
GGTTGTATATAGCCATGAATGGAGAAGGTTACCTCTACCCATCA
gtaagtaagacgccaaagatctcggccattcgttcaatgcatgtaaaataacaatggcag
caacaacaaaaagaaagttctatgtctgttgtttctgccagtttttgccttagtatttga
tctttgcgagaatgcttagaagctgtttattattcaccagtgtttagtaatatgagttta

 3.04 Term +  85693  85788   96  0  0   93   33   138 0.615   5.79
ttctccaggccagaggtcagagatcagtttcagtctgttcaaatcaagctgctagctggg
ccgtgctctctctggagcacttagagaataatctcttcctttcctttcctggtttccggt
ggtttccagcatcccttggcctgtggacacatcactcaatctctgcctctgtggtcacag
TGCCTTCTCTTCTGCGTATATCGGATCTCCCTCTGCCTTTCTTACGAGGAGACATATGTG
ATGGAACTTAATCTTTACCCAGATGATAAAGGATAA
tctcccaatgccaagatccttaacttaattgtatctgcaaaacttttttttctaataacg
taatctttactggttccagggattaagacctgatatatttggtggccattattcattcta
ctttaaatcccaatcacacactatcacgcccaatattggcagcttatttctaccaatcct

 4.01 Init +  93425  93495   71  1  2   36  103    65 0.284   3.37
ctggactaagaccaaatattttttaatcaaaaatcatatctcaattcttcattttagttt
taataccaaatatttatttaccttagatgaaaatggcatagtaatttaaaaaatcaaaca
aaaatagagacatcatctcaagaaaggagagaaaacgaagaagtaatcaatgcagagtct
ATGGCTGAGCAAGCTGGTGAAAAAACTTACAGAAGAAGTGTGATTAACAAGCACAGAGAA
CCCCAAGAATG
gtaagcgtgcacgcgcgcacacacacaaagtaaatataagcccatcatattcaaacggtt
gaaaaccaagcaaataacaatgtctaaaggcaaccaaaaaattgcaaggaatgaacaata
aaatttaagctgaccttctagtagaaagtatgaatcctgaagaaaaaaagaaagtaatca

 4.02 Intr + 102053 102174  122  2  2   81   80    17 0.243  -0.58
agccttcacaatgatgccaaaaatgatcaaagttttaatttgactgttaattcagatgaa
attccccttgtctctagctaagagggcttattccttctcttgcttatacccatcacccac
ctgtcagcactacactcctcagtttcttcctcatatcattcttgacttttgcctaatcag
GCACTCAGAACCACCGAGTTTCTTCTTGATAAAGTGCTTAGGAGAAATCTACATGGGGTG
GGGGGGTATTATCTCAATGGGCTACACCATCCTCTTCCAGCTGCAACTAGTTAGCACCTT
GG
gtgagctaaggaggagatcccttttaagtcattgaagggagtcaccactagtgctggtga
ctgtgataagatacgatgaagccctcacttagcttcatttatattgccttttgccaaagt
aactccaatccgcccttctcccttctcttgttttcagtgcttcttaaaatataaggttta

 4.03 Intr + 103929 103984   56  1  2   79   91    32 0.515   0.38
ctacttgctgagcctgtaagaataacttgatttcccctctaaataagtggaaacatccat
aacttcatccaacagcttacaacatggaaataaactgtttaatgaatgaattctttagtt
atgtcaatactaggtcctttgccctttaaaatgtttgttgctgctttctaccactttcag
TGGTCATTTACATTAAGCCTGATGATTGTTTTGGTTCCTCGAATCCCCTGTCAAAG
gtatgctgttattatggttttaggaacaagtatctctgcgaacagagtgttctgaagaag
gagtttacctacattaacttccattagaggtaatgcaattcaaatacctgatgcctttat
tttaattttaaatacatctgtttctggaacactttgtactgggccaatttgaaatactat

 4.04 Intr + 104529 104675  147  2  0   33  110    45 0.232   0.71
ctggtgaaggcttcttgctgcatcatctaatggtagagtgggtcaaaagtgccaaacaga
caaacgctgtgttctcacatggcagaagagtggggagagccaacccacccgctcaagccc
ttttactagagccccatttctatccatgagggctcagtcctcagtaacctcctcctaaag
CCCCCACCTTTTAAAACTATCACATTGGTCATTAAGTTTCAACATGGGAACTTTGGAGGA
CACACTCAGACCATAGCAGTGAGTTGGAGAGAAGGCATGGCCTGGTGGAAAGGACACTCG
TTTAAAATTCAGGAGATCTGGATGCAG
gtaagggttctttgggtacctccatgtgctaccataaggatgtcaccaactctcaccacc
tgtacacaaggaatggttttgccatgaacttcacctctttggcagtctgcttaagtcttt
gacttcaacatttaaagaaagcattttgaaatgcacaaaagtataggattgctaaggaaa

 4.05 Term + 106995 107084   90  2  0   89   36   138 0.979   5.44
ggatatgtgtgttttggagcaggatgcatatggaaaatcttcatacctttctctcagttt
ggctgtgacctaaaactgctctaaaaattaagtgtgtgtttttttaaataagtgaaacca
gtaaagattaagtgtcatacccaagttaggacccatgcttttccatttttttccctacag
CATCTTACGGAAAGGACAGGAATCCGAAATTTCTTTGAAAATCCAAGACAGTCAGAAATA
TTTGAAAAAGCAGAATATTTTGGAAACTAA
ataaaggccttcctgtctgtagaaatggattgtgaatcagcctaaagaaagagctccctt
gagggttggttattgatgtcaaaaatgtcctatcaggtttagaatgcaaagatgaggctg
taagacagagactgcacaaaggcaagataagagagggcttaagtgatgtggaagactggc

 5.03 PlyA - 108031 108026    6                               1.05
 5.02 Term - 115666 115368  299  2  2   65   42   333 0.824  20.84
 5.01 Init - 115968 115938   31  0  1   87   90    47 0.820   4.75
 5.00 Prom - 117534 117495   40                              -4.25

 6.01 Init + 128311 128386   76  0  1   44  109    30 0.389   2.00
aaaattcgtcttctcaccccagtttacctcgggtagtcctgagatcctttgaattttact
ggaaccttttaaagttggagaacccatgaacctcaggtgcatgacagcttatgctttaca
ttttgaagtgatccaaatgattagagaagaatttagaaacttacatgaatcaactttatg
ATGGTCAGAGAATCTGTGAAATATGTTTCAAAAAGAGGATCTAATTTAGCAGAGCGTAAG
GGGCATGATTTTCCAG
gtgagtcacaaattatgttttgggctgggaaatgaagaccaaatctcacaggactaacct
ggagatcagaaactggggcatgaaggcacctatgaatctctgaaaagttgataatattag
gtacttgctgacctgttgaggaagaaagaacccctaatggttccagaatcacaagcctgg

 6.02 Intr + 130337 130411   75  0  0   69  115    12 0.347   0.57
caccgggtaggaggacagaaaagaagacaggatgcttgctacccagaaagaaatgcagct
gacatgctctgaggagaggcagtcagtcatcagaaagcacagggagtttctcctgagaac
catgtagggttatgcgttgaggaaactgagctgcttgcagacacaatcctttttttccag
GGGTTTGTAACTCAGTGGAAAAACAGATCAGTAAAGTTAGATTTAAAATACAGTATAAGG
AACACTCTAATAAAG
gtaagtggagagagttatgcgatccataggaatggaaactagctggttttaaaggataaa
acagcggttcatccattcattcatatgacaataatcataaaaatggacagtgacagctat
tcaatatgctagatggtactttacagctttcaaaacacattcattagagcttaactttat

 6.03 Intr + 139249 139443  195  2  0  -27   71   195 0.634   4.76
tatctatagatacatacatagtcacacatgctcataaaaacacacaaccacagcaaaatt
catgctgtaatctataaacactttttagaaacggggagaggttgtgtgggcctaaagagc
caggtggggcagaacctaaaaggaccttgagaatgacaaacatttgaccatgggaagcag
GACAGGAGAAGGATGTTACAGCCAGTGACCATAGCATAGGTAAAAGCAAAACAGGTACCA
AGGAGCACACTGTACAGACCATTCAGCAAGGAGCCCAGCCTGACTGCCAGGAAGAGGCTG
CCTGCAGGAATGGTGTGGAAGACCATCAGCTGCAGACTGAGGCAAGGCGATGGAGGTTTA
GGCTTGCTTCAATAG
gtgagctacttacacaaggagaaccatgatgaaccatgatggaagtggtgttgcaacatt
cacatggtgtgggttgtactgggaagagatggacaatagggtggcttagcgatggcaacg
ggcatctttagatgagaagaatgtacgtgagatttcgaaaaaaatgatcaacagaattga

 6.04 Term + 141257 141432  176  0  2  102   45    54 0.645  -0.56
gaatgtacaaagaataccgaatgtactaagacagtattgcacataaattaccaggagaca
cagaagagtagctatagaacatgcttcatgcgaccagatctcagcaatgagatgtgctgt
ggaagaaccatgcgttttgttctgcagctgggattttcttatgctcttcttgcctttcag
TGACTCTAGCTGGAGCTGTGGTCTTCTCCATTTTGAAGGAGACACCCTCGAAGGCTGCCT
TTTGCCAGCTGAGATCTGACACTGATTTGTATAAATTGAGAGGGGATTTAGTCTATTGTC
CCAGAACTGAGGATGGAGTCCCTGAATGGCAAGCTTCAGATGAAAATACAGTCTGA
tgattatccatgtgtgccctgtacgctgccttgagaaatgcatcctaatgatgatggctt
caagttaaggtggtcatcataacaccaggtaattttcattttggcgtttcacggaacatc
tacctttccagaggacagttctaaattttaatagcttcacgttctggctgattagctgac

 7.03 PlyA - 145230 145225    6                               1.05
 7.02 Term - 153845 153741  105  2  0  100   47    92 0.810   3.73
 7.01 Init - 158499 158431   69  0  0   73   59    52 0.469   1.90
 7.00 Prom - 163058 163019   40                              -3.85

 8.01 Init + 174936 175044  109  2  1   92   87     9 0.351   1.63
gtatgacgcacattggttcagcctggaaaggcgggacaacttgaagcagggaggggactt
ccaggtcataggtagataagagaaatatgattgcattcttttgagtttctgattagcctt
tcagtgaatgcacaatttacagaaatagtcacttatgtcttcatctgctttagtggaaca
ATGGGGCAGAGGAAGCAATTAGACATGGATTTGTCTCATGTGAACAGAGGGATGACTTTG
AGTTCGGCCTGTCCACAAGGAATTTCCTTGTGGACAAATTGCGAGGGAG
gtatgtagcttttttatctttgtaactatcttatttaggaatagaatgggaggcagcttt
gcccaatgcatttcccagcttgactcttccctttgacttagtgattttggggtcctgaga
tttatttttctttcacatcttttaatcataactatggctaacatttattgagggcacact

 8.02 Term + 186997 187169  173  2  2   92   32   176 0.387   9.41
gaaatagttgccaatgttaaaaggagattatctgtagaaacttacatttcttacttcctt
tgaaaaatcagatcttctaaagatctaaggtttttattttcacaggagaaccatgtgagg
gacggctgcttttttaaaaaaatcattgcttctaccactgtcttcatctcctcaccacag
AGCCTGAGTCAGAGGCCATTTATCCTCATTACGGTGCCATGATCATGCCAGCTTTCCTCA
CTCCTGTATCTACCTGGTCATTAGAGGCATTTGAGTTTGTGGCCCGTGCTGTGCACATTA
TCCCTGGAGATCTCATCAATTACAATTATTTCCACCTACTGGACTTTAAGTAG
ttctacctattggacattttcaatgcaatctgttttcctaaagcatactgcaggattgaa
gcacaaagtatgactgtgcaattactctcaagagcatttttgtttatgttggtcaatgtc
agttttttaggtcccttataaggaaataccttttaaaaattcatgccaagaaacttttca

 9.01 Init + 190464 190511   48  2  0   80   82     7 0.865   0.30
ttaatgcagaccatggcattgagcataatagtatttaacaaactgtatgctttccaaaaa
tgctgtgtggtttttcagttggagcagcttttgatgtttatcttcaagagttccaacggg
actcaaacctttggagccccattgaattattttcagctactgtcactatgaccagctaac
ATGACACCTAACCTCATCTGGTTATACAATAGCTCTAGTGGCTGGCAA
gtaagccagctgattgtctaagttttagtttgaggtttcagtttgttcctttgtaagtaa
aatgtatcaccctgtgatttcagtgatccaaggagcaactggcaactgtagagtattata
tcactgttcctatggaaacatgtaaaatggattataaaatatctgaaatgtgtattttat

 9.02 Intr + 191036 191234  199  1  1  150  113    43 0.866  11.00
ctcaatttattgtatattttaaaaatgtatagacaattactgtgcgcaggaaggggtata
tccggtcctccatgccaaagcactctttcaccatgctgggaaactttctagagaatgagt
agaatgtacagtgaagatcaagttccttcctctaacttttgtttcattttctctccacag
GAACTTTTTACCCCTGAATGCAAGTTTAAAGAATCTGTTTTTGAAAATTATTATGTAATC
TACTCATCCATGTTGTACAGACAACAGGAATCTGGTAGAGCCTGGTTTTTGGGATTAAAT
AAGGAAGGGCAAGCTATGAAAGGGAACAGAGTAAAGAAAACCAAACCAGCAGCTCATTTT
CTACCCAAGCCATTGGAAG
gtgagtattatgcatgcattattattacatagacttattacatattttatttttcaaatt
gataggtctaccatggctctaagaaaccttcacaaagtgctggaaatgtcatttattttg
atctaggtgatggttgcacaggtgcctacttaagttattgatttagaatttgtgcccctt

 9.03 Term + 194669 195015  347  0  2   38   42   217 0.335   5.77
gtgcagtggaagggatgtctgagttttctttttttgagaattaagttaaatgcctgtcat
tctcctatagtgtgtgtgtgtgtgtgtgttttacatcatggacccacaaagaggccatag
ctcccatttaaacctgctgtcctagacaaaaatccatgcacactcatatacatattttag
GTATACAGACCAGAGAATGTGAAGGGAGTAATGTCCTCTGTGGGCTGGAAATGATTGCTT
TACAACAGGAATTCTGTCTCAATGGAATTGCTTTACTTCAGGGAAAACAGAAATGGGCAA
ACTGCAGTGGTCTATGCAGGTATGGATGGACCATTCTCACACCTAACCAAGCAATGTTTG
CTTTTCCTCCTCCTTTCTTCCCATCACTAGTTGCCATGTACCGAGAACCATCTTTGCATG
ATGTTGGGGAAACGGTCCCGAAGCCTGGGGTGACGCCAAGTAAAAGCACAAGTGCGTCTG
CAATAATGAATGGAGGCAAACCAGTCAACAAGAGTAAGACAACATAG
ccagatcctcacaggtgttgtgacttattcgtcctgagcacagttgagtgatttatcctc
accagacattcctgctccgtggctgaagagcagcaggaagtaagctaatgcttattcttt
gctgtctccgaacttctctgttgcaagtggataaatctcaacctgttgcaccccccacaa

Predicted peptide sequence(s):


>FGF14_1|GENSCAN_predicted_peptide_1|94_aa
MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRR
LRRQETSRVPRPWTNVDILAVPPAGAAVEGVEGV

>FGF14_1|GENSCAN_predicted_peptide_2|315_aa
MAILPKVIYRFNAIPIKLPMTFFTELEKTTLKFMWNQKRARIAKSILKQKNKAGGIMLPD
FKLYYKATVTKTAWYWYQNRDIDEWNRTEPSEIMPHIHNYLIFDKPDKNKKWGKDSLFNK
GCWENWLAISRKLKLDPFLTPYTKINSRWIKDLNFRPKTIKTLEVNLGNTIQDIGMCEDF
MSKTPKAMATKAKIDKWDLIKLKSFCTAKETTIRVNRQPTEWEKIFAIYSSDKGLISRIY
NELRQICKKKTNNPIIKWVKDMNRHFSKEDIYAAKRHVKKCSSSLAIREMQIKTTMRYHL
TPVRKAIIKKSGNNR

>FGF14_1|GENSCAN_predicted_peptide_3|112_aa
MKDLKRKTADPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVA
IQGVKTGLYIAMNGEGYLYPSCLLFCVYRISLCLSYEETYVMELNLYPDDKG

>FGF14_1|GENSCAN_predicted_peptide_4|161_aa
MAEQAGEKTYRRSVINKHREPQEWHSEPPSFFLIKCLGEIYMGWGGIISMGYTILFQLQL
VSTLVVIYIKPDDCFGSSNPLSKPPPFKTITLVIKFQHGNFGGHTQTIAVSWREGMAWWK
GHSFKIQEIWMQHLTERTGIRNFFENPRQSEIFEKAEYFGN

>FGF14_1|GENSCAN_predicted_peptide_5|109_aa
MAKGDTKKPKEVHFKVKSANPGIRGKKLGEMWNNLSDRTKQTDITKAEKLKERYEKDVAD
SKCKGEFDGSKHPTKVAWKKVEEEDEENMEDKEEGEEEDEKKTVLSVSL

>FGF14_1|GENSCAN_predicted_peptide_6|173_aa
MVRESVKYVSKRGSNLAERKGHDFPGVCNSVEKQISKVRFKIQYKEHSNKGQEKDVTASD
HSIGKSKTGTKEHTVQTIQQGAQPDCQEEAACRNGVEDHQLQTEARRWRFRLASIVTLAG
AVVFSILKETPSKAAFCQLRSDTDLYKLRGDLVYCPRTEDGVPEWQASDENTV

>FGF14_1|GENSCAN_predicted_peptide_7|57_aa
MNPRVIRMAKDHNASVGNKQLAECEFEVRKLTSPEQQLTKVAEASKKSVPWGTGIHH

>FGF14_1|GENSCAN_predicted_peptide_8|93_aa
MGQRKQLDMDLSHVNRGMTLSSACPQGISLWTNCEGEPESEAIYPHYGAMIMPAFLTPVS
TWSLEAFEFVARAVHIIPGDLINYNYFHLLDFK

>FGF14_1|GENSCAN_predicted_peptide_9|197_aa
MTPNLIWLYNSSSGWQELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQ
AMKGNRVKKTKPAAHFLPKPLEGIQTRECEGSNVLCGLEMIALQQEFCLNGIALLQGKQK
WANCSGLCRYGWTILTPNQAMFAFPPPFFPSLVAMYREPSLHDVGETVPKPGVTPSKSTS
ASAIMNGGKPVNKSKTT