GENSCAN 1.0	Date run: 15-Jan-104	Time: 04:47:23

Sequence TFCP2_1 : 80442 bp : 42.04% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1660   1781  122  0  2  101  105   186 0.991  21.31
gggtacgggagattagttgtgcacagagcagtgctggtcgggcttgggggtggctggtgg
gcactgcgtgggaaaccttggtttgtagttttcttggtttgcgttactcctgttgggtag
aattaccctccgcgcctttgtacaagacacggtgtctcctggggcaaggaaggagccagg
ATGGCCTGGGCTCTGAAGCTGCCTCTGGCCGACGAAGTGATTGAATCCGGGTTGGTGCAG
GACTTTGATGCTAGCCTGTCCGGGATCGGCCAGGAACTGGGTGCTGGTGCCTATAGCATG
AG
gtgagtgagattttcccagaccctacaccttctgaataacaaaggcggatagacactaag
aaaaggggttgagtgggaaggaggtgtatagagttttaaaaagctgtttacgattgggga
aaagggacttgttcttttgtcgctttgagtagttagtgttgtggaagaaatggaaaaagc

 1.02 Term +   2800   2845   46  1  1   75   50    55 0.901  -3.90
gaggttgcagtgagcagagatggtgtcattgcactccagcctgggcaacaaagtgagact
ccatttgaaaaacaaagcaaaacaaaacaaaaactcctttgaaagcaacattattgccta
tataacttgttgcatgcattggctgcttcattcctccagtatagtttatttcatttatag
ATGTGTAAGAATCCTGTATGGAAATGTTGAAACAGCTGCATCTTAG
gggtagatggactataattgggtttcctaatgcattattaagacttaatctaaataagtg
agtcaagagactagaacttaacattttcattgggtttatgagttcataggggaaagatgc
tttttagggggaaagtagatgcatttttcattctgataatgagatcttttaagagttata

 2.01 Init +  48675  48701   27  2  0   88  127    31 0.793   6.69
aggttagacagaagggctaaagaaagcagaagcaaagaacagagtatattagttactttt
caattagttactttttcttacaaggctgggagagggagacagaacaatagaaaaataact
ggttgattcatatggaggtcagagtggaagcaggtgtgagagggtcccacagaagaaaac
ATGGCAGCCAAAGTGTTTGAGTCCACG
gtaagtttggcttggccttagctgttgcaggagacctgtgaactctgccttatataatgt
ggatgttgggcacagagctgtcatctttgactgattccaggacaaaaatgacaggacatt
gtggtaggggactcactttctcatcccatgggtacagaaaccaattatctttgcctttct

 2.02 Term +  48816  49454  639  2  0   -6   43   706 0.574  49.92
gagtggaagcaggtgtgagagggtcccacagaagaaaacatggcagccaaagtgtttgag
tccacggtaagtttggcttggccttagctgttgcaggagacctgtgaactctgccttata
taatgtggatgttgggcacagagctgtcatctttgactgattccaggacaaaaatgacag
GACATTGTGGTAGGGGACTCACTTTCTCATCCCATGGGTACAGAAACCAATTATCTTTGC
CTTTCTCCACCACGTAATGTACCAATCATCACTGGTAGCAAAGATTTACAGAATGTCAAT
ATCACACTGCGCATCATCTTCCAGCCTGTTGCTAGCCAGCTTCCTCGCATCTTCACCAGC
ATCGGAGAGGACTATGATGAGCCTGTGCTGACGTACATCACGACCGAGATCCTCAAGTCA
GTGGTGGCTCGCTTTGATGCTGGAGAAGTTATCACTCAGAGAGAGCTGGTCTCCAGGCAG
GTGAGCAACGACCTTACGGAGCAAGCAGCCACATTTGGGCTCATCCTGGACGACGTGTCC
TTGACATATCTGACCTTTGGAAAGGAGTTCACAGAAGCAGTGGAAGCCAAACAGGTGGCT
CAGCAGGAAGCAGAGAGGGCCAGATTTGTGAAGGAAAAGGCTGAGCAGCAGAAAAAGGCT
GAGCAGCAGAAAAAGGTTGAGCAGCAGAAAAAGGCAGCCGTGATCTCTGCTGAGGGCGAC
TCCAAGGCAACCGAGCTGATTGCCAACTCACTGGCCACCGCGGGGGACGGCCTGATGGAG
CTGTGCAAGTTGGAAGCCGCGGAGGCTCTCGGAACATGA
cctacctgccggcggggcagtccgctcctccggctgccccatgagggcccaccctgcctg
cacctccgcaggctgactgggccacagccccaatgattcttaacactgccttacccccct
accccagaaatcactgaaatttcataattggcttaaagtgaaggaaataaaagtaaaatc

 3.01 Init +  55209  55461  253  2  1   26   72   120 0.382   1.75
gtttataatttccacagtccttttaggaacccctgtctatgattcctagaaacattctct
ttaacacttagtggttttagcagtgaatatctgtcatcacccacactgttgtggtcaggg
ggatatcacagcaggtaatctaaatggaattcttgggatgaaactccaccaaggtgagta
ATGTTTATGGCTTTCCAAAGCATTGCAGTTAAATCATTCAGCAATAAACCTGCGTTTGCA
CCATTGCCAGGTATTAATGTGAGTCATTTGTTTTATTTTAGTGATGTCCTTGCATTGCCC
ATTTTTAAGCAAGAAGAGTCGAGTTTGCCTCCTGATAATGAGAATAAAATCCTGCCTTTT
CAATATGTGCTTTGTGCTGCTACCTCTCCAGCAGTGAAACTCCATGATGAAACCCTAACG
TATCTCAATCAAG
gttagatgcttcctcattcattagtactattgcagacctactgtatttatgatttttttg
tttgtttgtttgttttgagacggcgtcacccaggctggagtgtagtggcgccatcttggc
tcactgcaagctctgcctcccgggttcacaccattctcctgcctcagcctcctgagtagc

 3.02 Intr +  56335  56411   77  2  2   98   93   126 0.995  12.42
tgagataatgtgacaatacttagcacagtgctgagcatcttgtaaaggcttctgattgtt
gttactaatactaataatattattatactgttgtatattcaaccaactgaattttattct
ttccgaatctagcaaagttaatttgtggtgaatataatatgtaattactttttcttctag
GACAGTCTTATGAAATTCGAATGCTAGACAATAGGAAACTTGGAGAACTTCCAGAAATTA
ATGGCAAATTGGTGAAG
gtaaaacgaataaatcattcttctgtacaatattttttactaatccttttgggattttaa
attttgttgttgttgttaatgttcttttgcttccaatggcttaatggtatctcttgcctg
cagtaatttgttggcagagtagtaagctgatgtgttatttctttggggtcagagtaagcc

 3.03 Intr +  57662  57767  106  1  1   84   95    99 0.996   9.07
aaaattttatcctgaaatagcacttagtatggtatgggttttagagtgaaacagatctta
agaaaaataattttagattgcgtttagaaacaaactggcagtgaatcctgctagtttttc
tttgtcagcactgattttcaagaggtcttgttatcatctgattttgttgtatccttttag
AGTATATTCCGTGTGGTGTTCCATGACAGAAGGCTTCAGTACACTGAGCATCAGCAGCTA
GAGGGCTGGAGGTGGAACCGACCTGGAGACAGAATTCTTGACATAG
gtgagttaagagaatctattgcctaggaaatgcctttagctatggacccagagttggttt
tctttatttgacatttaccttgattcatatgcttgagaggctcaattagtataaaccttg
aaattatttactaagcataaaaaattttaagtaatacaagttaaaatgatatcaaaattg

 3.04 Intr +  63099  63205  107  1  2   95  110    45 0.987   6.41
ggcaacagaacaagactccataaaaaacaacaacaacgacaaaaaaaaaaaacaaagaaa
tttaggatgtgatatacaaaaatcttggtagctacattgagtaatataagaatcaatgct
ttcttatttaaaactgagtggccctcaaaattgttcaatgattaccattttgtttctcag
ATATCCCGATGTCTGTGGGTATAATCGATCCTAGGGCTAATCCAACTCAACTAAATACAG
TGGAGTTCCTGTGGGACCCTGCAAAGAGGACATCTGTGTTTATTCAG
gtaaggcgttgcagatagggttccagttttgaagagtatctctcttactatcagtttatt
tcttaaaggataaaacatgttaactttgaaatctttacagggttctagcctgactgtcaa
gcccaggctctttaacctgtgcctgagagcattgaggagtttctgaattgctcttctaat

 3.05 Intr +  64809  64961  153  2  0  105   61    93 0.973   7.65
gcatttttctatttcctctatcagattgtaagttcttcaagatcaaaaagaggaaaagtg
ttttttgtaggtattcataatgcctggtaaaggttttgctgttaatagttgctaaaaaaa
tactgccaactggtttggctagctagcggtactgaagccttgctgttgtattcttttcag
GTGCACTGTATTAGCACAGAGTTCACTATGAGGAAACATGGTGGAGAAAAGGGGGTGCCA
TTCCGAGTACAAATAGATACCTTCAAGGAGAATGAAAACGGGGAATATACTGAGCACTTA
CACTCGGCCAGCTGCCAGATCAAAGTTTTCAAG
gtattcctgggcaatgtgctggcccttggattcttttaccttatcattctattttaacat
tagttaccaagtcagaaaatcaacttgtctttttttgaaaactcacacacacgcaaaaag
tctaagctagagtcattgaaataattaccaagatgcctggtaaagaaatttacatggtcg

 3.06 Intr +  66736  66846  111  0  0   59   83   129 0.997   9.16
tcaactccatcgaatataaacatttaaatttcctattttcaaacttaaagtgatgtgtct
tgcctttacatcactgcacatacaattttgtttcatacatgaatatttaagtttttggaa
gcaatattttgggttaaaaggtgagtacctgaatttaaaacaaaatatttctcatttcag
CCCAAAGGTGCAGACAGAAAGCAAAAAACGGATAGGGAAAAAATGGAGAAACGAACACCT
CATGAAAAGGAGAAATATCAGCCTTCCTATGAGACAACCATACTCACAGAG
gtaaaaagatttcttttggtgacaatttcagttcataatttttaatcttaaaaattcatc
acttccaaactggtcagaatttacttctcctaagccttgagggacacagtatcacatgga
ttctgtgtccagcggccttaacaggaagattgctttagaatttggcacgaaccatgccac

 3.07 Intr +  67469  67557   89  1  2   84  110    -4 0.718  -0.75
agcaggcctccccacaggctccaagatggcggaaagagaagcagtgttctctattgctta
tgggagtctctgaggaattaagatttactaatcaagatgtgctattcaagtaacaatgtt
ttagtcaaatcctggggtcatatgtgctcgttcattatctaacttatcctttgtttttag
TGTTCTCCATGGCCCGAGATCACGTATGTCAATAACTCCCCATCACCTGGCTTCAACAGT
TCCCATAGCAGTTTTTCTCTTGGGGAAGG
gtaagtctgggaaataaaattggcttatatttgtccaaaatatatattctttcattacct
gttcataaacaagatcttttttaaatcaataagtatatctatttggtcgttctttgatgg
atttatatattaactgagatttggagtagcttcaaaagagatcgaaagagttttatatag

 3.08 Intr +  74303  74427  125  2  2  115   86   105 0.933  12.31
gaaaaaaaaaaccctactactggggaactaataaaacatagcaaattaattgcatttggc
caatgagcttccaattttcatctgctctatacgattaatgtagaaacacaatttctccct
tctttttattgtgcttaccataaagaatgtaagactaattagcctttttcctccccttag
GATGGTGCGTCCAAGGTTAACCATTTATGTTTGTCAGGAATCACTGCAGTTGAGGGAGCA
GCAACAACAGCAGCAGCAACAGCAGCAGAAGCATGAGGATGGAGACTCAAATGGTACTTT
CTTCG
gtaggttgttctggacacactaggacagatatgaagaaaggtgaagagataacttatggg
catgtgtgatgggaaactatcaaacagcagatttagtatttgctagaagtaacaataatc
actagcatttattaagttcctaatacatggcaggtgccattctttttttttttttttgag

 3.09 Intr +  75164  75306  143  0  2  117   61    89 0.966   8.25
ggcctaggaatgttaaataacttgccctaggtcacacagctgcaagtggttgagccagga
tttgaacttaggcagtgtgatttctgagtccttcagaaaagtgggcattcctagtgatca
agttacctgtaagagtggacaaactttgtactgactgctgttgctctctcccttttgcag
TTTACCATGCTATCTATCTAGAAGAACTAACAGCTGTTGAATTGACAGAAAAAATTGCTC
AGCTTTTCAGCATTTCCCCTTGCCAGATCAGCCAGATTTACAAGCAGGGGCCAACAGGAA
TTCATGTGCTCATCAGTGATGAG
gtagatttttcagtacagttgaattaccagatgatgattaatttgtcagcgcatggagca
agagcagttctcctggggcagagtgttctgttttctagatcagagggtttcatacttttt
tgcttgctttcctcctaattttttttttttttgaaacagtctctctctgttgcccaggcc

 3.10 Term +  78906  79106  201  2  0   31   43   146 0.556   0.81
atcttaccatactttttttctcctgctgtgttttagaggtgactaaagatgattctctct
ctctcttttttttaacagcagaaaccaatgatagctatcatatcatactgaagtaggagt
gcggcgtttcgtgcccagtggctgctccttccttcacctctgaaaacggccctcttgaag
GGGGATATGAATGGAGATTTGAAGGTCTGCAAGAACCTGACTCGTCTGACTGTGTGTGGA
GGAGTCCAGGCCATGGAGGCAGAATCCTGGCCCTCTGTGTTGGCCCAAGCTCTTGTGGTA
CACACAGATTACTGCCCAATATGCAGTTCTGCAGCTGTTTTAGTTAAATTTCTGGACCTT
GTTGTTGTTAAATATCAGTAG
aaactctacataatttagagtgtatgtagggcataatgatgatgggaattgtgtgatgtt
taacaggaagatcttaaattttgtgatatggagccctgtaatttttttcttatataaaaa
tgggtatctatattcataagactaggtcttcaatctctttgtactggtctcaaatgtact

Predicted peptide sequence(s):


>TFCP2_1|GENSCAN_predicted_peptide_1|55_aa
MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMRCVRILYGNVETAAS

>TFCP2_1|GENSCAN_predicted_peptide_2|221_aa
MAAKVFESTDIVVGDSLSHPMGTETNYLCLSPPRNVPIITGSKDLQNVNITLRIIFQPVA
SQLPRIFTSIGEDYDEPVLTYITTEILKSVVARFDAGEVITQRELVSRQVSNDLTEQAAT
FGLILDDVSLTYLTFGKEFTEAVEAKQVAQQEAERARFVKEKAEQQKKAEQQKKVEQQKK
AAVISAEGDSKATELIANSLATAGDGLMELCKLEAAEALGT

>TFCP2_1|GENSCAN_predicted_peptide_3|454_aa
MFMAFQSIAVKSFSNKPAFAPLPGINVSHLFYFSDVLALPIFKQEESSLPPDNENKILPF
QYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPEINGKLVKSIFRVVFHDR
RLQYTEHQQLEGWRWNRPGDRILDIDIPMSVGIIDPRANPTQLNTVEFLWDPAKRTSVFI
QVHCISTEFTMRKHGGEKGVPFRVQIDTFKENENGEYTEHLHSASCQIKVFKPKGADRKQ
KTDREKMEKRTPHEKEKYQPSYETTILTECSPWPEITYVNNSPSPGFNSSHSSFSLGEGM
VRPRLTIYVCQESLQLREQQQQQQQQQQKHEDGDSNGTFFVYHAIYLEELTAVELTEKIA
QLFSISPCQISQIYKQGPTGIHVLISDEGDMNGDLKVCKNLTRLTVCGGVQAMEAESWPS
VLAQALVVHTDYCPICSSAAVLVKFLDLVVVKYQ