GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:05:21

Sequence STAT2_1 : 19795 bp : 47.89% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   4737   4867  131  2  2   80   81   140 0.810  12.14
aggggaaagaaccaagattagcagtaggatcaacatatattttaatgttttctgtatttt
tattacttgtataatttaaacattttaaattagtaataatgaacaatcatgaaactatgg
atgatttagtccagcaaaatatccaattgggaaccctcatccttctgacgcagagcccaa
ATGGCGCAGTGGGAAATGCTGCAGAATCTTGACAGCCCCTTTCAGGATCAGCTGCACCAG
CTTTACTCGCACAGCCTCCTGCCTGTGGACATTCGACAGTACTTGGCTGTCTGGATTGAA
GACCAGAACTG
gtgaggccttcaggaagttgggggaatgaaaaaggtggttccttacttctgggcccccgg
gatcctggaatcattaatggcaggaaggggttggaaagcctcaggactacagtaacactg
cagagacactaatacttcttattcctggtgcccaggcaggaagctgcacttgggagtgat

 1.02 Intr +   5023   5176  154  1  1   64   80   159 0.971  12.77
ctgtctggattgaagaccagaactggtgaggccttcaggaagttgggggaatgaaaaagg
tggttccttacttctgggcccccgggatcctggaatcattaatggcaggaaggggttgga
aagcctcaggactacagtaacactgcagagacactaatacttcttattcctggtgcccag
GCAGGAAGCTGCACTTGGGAGTGATGATTCCAAGGCTACCATGCTATTCTTCCACTTCTT
GGATCAGCTGAACTATGAGTGTGGCCGTTGCAGCCAGGACCCAGAGTCCTTGTTGCTGCA
GCACAATTTGCGGAAATTCTGCCGGGACATTCAG
gtacttggaacggttgggagtgatggggtagcactgggagctgagcatagaggagtaagg
tttggagaatagaatagtacctggaggtggaaagggagacgggaacaaatgtggggaaag
gaggacagagtctggacttggggaatcactagcagagagaagggttgcatatacgtgaca

 1.03 Intr +   5776   5865   90  0  0   57   88    87 0.982   5.79
aattggtgaggacaattcagtggtaatgttggaaactcctgaagtagagaggaaccatgg
aaaggactcagggagttgtctcagaacaggatccccccgacatcctgtggtataatttca
ggcctgaacttaaggcatgaaaggccagagttaaaacgtgctcagagcctcttttttcag
GAACAAGGAGAGCCAGTTCTCGAAACACCTGTGGAGAGCCAGCAACATGAGATTGAATCC
CGGATCCTGGATTTAAGGGCTATGATGGAG
gttagtagatgtggtaggagttagggttgacagcgttcagcctaacacctccctgagaag
cagcctcatcggggtcctctcccctctgcagaagctggtaaaatccatcagccaactgaa
agaccagcaggatgtcttctgcttccgatataagatccaggccaaaggtaggaagcacat

 1.04 Intr +   5957   6032   76  1  1   89   97   101 0.998  10.19
aacaaggagagccagttctcgaaacacctgtggagagccagcaacatgagattgaatccc
ggatcctggatttaagggctatgatggaggttagtagatgtggtaggagttagggttgac
agcgttcagcctaacacctccctgagaagcagcctcatcggggtcctctcccctctgcag
AAGCTGGTAAAATCCATCAGCCAACTGAAAGACCAGCAGGATGTCTTCTGCTTCCGATAT
AAGATCCAGGCCAAAG
gtaggaagcacattgaggggctggagaaagataagtgcctgctgagaagccggagctgga
agtgaacaggagaaagctccgatgagcagtagtcactgtcagacacaccccactgactac
agtcctgctgccgtgcaaagctggaagtgctttgtggaggctgagctggaggtgcagctg

 1.05 Intr +   6445   6530   86  2  2   65   81    64 0.998   2.94
agggggtgtctggtccaagcatgaccattcagaatttgcctgagggtcccacaggtgcct
gtgctttgcttggtttccctttcttcctccacaaaattcctccttcctgactctgactga
gaccccagtcaggaaggagaggaaagaacccctggactgactcctgttcccaccatccag
GGAAGACACCCTCTCTGGACCCCCATCAGACCAAAGAGCAGAAGATTCTGCAGGAAACTC
TCAATGAACTGGACAAAAGGAGAAAG
gtgggagacagaggacagaacatgtgggcaacaaggacctggaaaaatgagggatgtggg
gaccctggtcctctagcgctggcttctttgtttcttcatccccagttgggtggtggaggg
tgaaagggagagatgctcaacactcacattatctctttcccaggaggtgctggatgcctc

 1.06 Intr +   6694   6842  149  0  2   78   81   175 0.994  14.83
tggacaaaaggagaaaggtgggagacagaggacagaacatgtgggcaacaaggacctgga
aaaatgagggatgtggggaccctggtcctctagcgctggcttctttgtttcttcatcccc
agttgggtggtggagggtgaaagggagagatgctcaacactcacattatctctttcccag
GAGGTGCTGGATGCCTCCAAAGCACTGCTAGGCCGATTAACTACCCTAATCGAGCTACTG
CTGCCAAAGTTGGAGGAGTGGAAGGCCCAGCAGCAAAAAGCCTGCATCAGAGCTCCCATT
GACCACGGGTTGGAACAGCTGGAGACATG
gtgagaggtaccaccccaaccctcgtcctcgccatgcgctgtgatttgtaagttgcagtg
ccctgcatatagcaagagatactgttctctatttgtctctgctccccagaatgagccctg
ctccctgctgactgcagctctattctgctcctcatcctcaccacgcagggagcccagagc

 1.07 Intr +   9858  10016  159  0  0   66   30   122 0.905   3.30
attttcatttcttggattatgaatcatgttgaataatcctttatatgcttcctggattct
ttttttttcttccccccagtcagtttctgactcttcacatatttacagagagatcttgga
acctggatgggggaatccaggaaactcatggattccttcttcctgaattttatcacccag
GTTCACAGCTGGAGCAAAGCTGTTGTTTCACCTGAGGCAGCTGCTGAAGGAGCTGAAGGG
ACTGAGTTGCCTGGTTAGCTATCAGGATGACCCTCTGACCAAAGGGGTGGACCTACGCAA
CGCCCAGGTCACAGAGTTGCTACAGCGTCTGCTCCACAG
gtctagaggccaggcaggaaccctgggggaaagaaggaacaagggaagccattcttacag
atactgagctatatattctctccacacctctctctcctcagagcctttgtggtagaaacc
cagccctgcatgccccaaactccccatcgacccctcatcctcaagactggcagcaagttc

 1.08 Intr +  10118  10210   93  2  0  103   58    87 0.986   6.28
atcaggatgaccctctgaccaaaggggtggacctacgcaacgcccaggtcacagagttgc
tacagcgtctgctccacaggtctagaggccaggcaggaaccctgggggaaagaaggaaca
agggaagccattcttacagatactgagctatatattctctccacacctctctctcctcag
AGCCTTTGTGGTAGAAACCCAGCCCTGCATGCCCCAAACTCCCCATCGACCCCTCATCCT
CAAGACTGGCAGCAAGTTCACCGTCCGAACAAG
gttggcattccagaactcattcccacttcctttttccaaccctgccactgtgtattttct
ggctttacagctcttcccactcttggctttttcttctctttccctgcaatctccctacct
cttataatccctcttctctttttcaaacatctagtctatccggaaggttgaggttgacca

 1.09 Intr +  10420  10479   60  1  0  120   99    74 0.998   9.55
ctttttccaaccctgccactgtgtattttctggctttacagctcttcccactcttggctt
tttcttctctttccctgcaatctccctacctcttataatccctcttctctttttcaaaca
tctagtctatccggaaggttgaggttgaccactttcccctatcccccttccttcccccag
GCTGCTGGTGAGACTCCAGGAAGGCAATGAGTCACTGACTGTGGAAGTCTCCATTGACAG

gtaaattggagcaggtgaagggtggccaggacacgggctgctggggtggaggagatactc
actcttcacaacagggccctagggctatctccttcctccttccaatcctacctcacagaa
attataattcatttcttttgttgaacacttactttgtgacatgcagcatgtcagctactc

 1.10 Intr +  11118  11211   94  0  1   53   99    19 0.999  -0.53
atgacctgcagaaccacattcggcagccctggtggcacaaacaaggaagagggggatttg
ggatatggacaaagggagatggcgagatctgaaatgaagtggaacttctgtttttttttt
tctgctgagtttttagaataattccattccttgtctccatgtatcttcctcctggaacag
CTTCCGGAAGTTCAACATTCTGACTTCAAACCAGAAAACTTTGACCCCCGAGAAGGGGCA
GAGTCAGGGTTTGATTTGGGACTTTGGTTACCTG
gtaagaatagtttgtgacctatgcttttattactatttttatttttttgagacggagtct
cactctgtcccccaggctggagtgcagtggtgccatcttggctcacagcaacctccgcct
cccgggttcaagcaattcttctgtctcagcctcctgagtagctgagactataggcacaca

 1.11 Intr +  11672  11719   48  1  0   96  100    50 0.983   5.88
tcagcctcccaaagtgctgggatcacaggcatgagccaccatagctggcctgcttttagt
ccaaaggaacaggggttgggggaagttcccagggcttgagaggtcttgaagccaaacagg
ggttccagggacactagggtgcccactctggcattttctctccttcccttcaattcacag
ACTCTGGTGGAGCAACGTTCAGGTGGTTCAGGAAAGGGCAGCAATAAG
gtgagatctggacagaggactcgaggcagggggagcttgccaaagagccttctgatgact
atgtctttggctgtcccaggggccactaggtgtgacagaggaactgcacatcatcagctt
cacggtcaaatatacctaccagggtctgaagcaggagctgaaagtgagtgaaaatggagg

 1.12 Intr +  11799  11882   84  2  0   87   87   113 0.999  11.12
gggacactagggtgcccactctggcattttctctccttcccttcaattcacagactctgg
tggagcaacgttcaggtggttcaggaaagggcagcaataaggtgagatctggacagagga
ctcgaggcagggggagcttgccaaagagccttctgatgactatgtctttggctgtcccag
GGGCCACTAGGTGTGACAGAGGAACTGCACATCATCAGCTTCACGGTCAAATATACCTAC
CAGGGTCTGAAGCAGGAGCTGAAA
gtgagtgaaaatggagggcaaggagagagaaagcagctttggaagaaggcataagaaggg
gataaacagaagcctcttggggtgggttagcactcctttcctctaacaaatacctgcagc
tagaaacatcacatccctctctgtgactcctgtcttctccccagacggacaccctccctg

 1.13 Intr +  12047  12145   99  1  0  108   91   -18 0.616   0.81
gaagcaggagctgaaagtgagtgaaaatggagggcaaggagagagaaagcagctttggaa
gaaggcataagaaggggataaacagaagcctcttggggtgggttagcactcctttcctct
aacaaatacctgcagctagaaacatcacatccctctctgtgactcctgtcttctccccag
ACGGACACCCTCCCTGTGGTGATTATTTCCAACATGAACCAGCTCTCAATTGCCTGGGCT
TCAGTTCTCTGGTTCAATTTGCTCAGCCCAAACCTTCAG
gtaggggagtggggccgacaggtcaaggcgcgagaggaggggtgtggaagcttggtgtga
taggttgcttctgagccagcctacactgctcccacccctgcagaaccagcagttcttctc
caacccccccaaggccccctggagcttgctgggccctgctctcagttggcagttctcctc

 1.14 Intr +  12249  12384  136  2  1  101   17    95 0.968   3.84
ttatttccaacatgaaccagctctcaattgcctgggcttcagttctctggttcaatttgc
tcagcccaaaccttcaggtaggggagtggggccgacaggtcaaggcgcgagaggaggggt
gtggaagcttggtgtgataggttgcttctgagccagcctacactgctcccacccctgcag
AACCAGCAGTTCTTCTCCAACCCCCCCAAGGCCCCCTGGAGCTTGCTGGGCCCTGCTCTC
AGTTGGCAGTTCTCCTCCTATGTTGGCCGAGGCCTCAACTCAGACCAGCTGAGCATGCTG
AGAAACAAGCTGTTCG
gtacagatttccttttctctcagcctttccccagccttagtcttttctgtccctctgtcc
tatctatcccaggacccctggcttccctcatcatctgtctgtggctatctgtcccacagg
gcagaactgtaggactgaggatccattattgtcctgggctgacttcactaaggtaactcc

 1.15 Intr +  12504  12556   53  1  2  121   88    -9 0.864   1.03
tcctatgttggccgaggcctcaactcagaccagctgagcatgctgagaaacaagctgttc
ggtacagatttccttttctctcagcctttccccagccttagtcttttctgtccctctgtc
ctatctatcccaggacccctggcttccctcatcatctgtctgtggctatctgtcccacag
GGCAGAACTGTAGGACTGAGGATCCATTATTGTCCTGGGCTGACTTCACTAAG
gtaactccctgaatcctgtggagctgctggatctagcccacattccaaatactggccttc
ccacgtccctccttccctacaccagaggcaactcctcagcttttgctacctttccattcc
tcctccagcgagagagccctcctggcaagttaccattctggacatggctggacaaaattc

 1.16 Intr +  12685  12779   95  0  2  102   82    60 0.890   5.56
gcagaactgtaggactgaggatccattattgtcctgggctgacttcactaaggtaactcc
ctgaatcctgtggagctgctggatctagcccacattccaaatactggccttcccacgtcc
ctccttccctacaccagaggcaactcctcagcttttgctacctttccattcctcctccag
CGAGAGAGCCCTCCTGGCAAGTTACCATTCTGGACATGGCTGGACAAAATTCTGGAGTTG
GTACATGACCACCTGAAGGATCTCTGGAATGATGG
gtaaggccttggtcacccttccctcatgggcttgtgctttccgggcttgagagtggagtc
tctgcaccctcacgtggcaagcagggagagagagcaaagacaggtgcaggccacgtctcc
tcacatttgttaacaataataaggccgggtgtggtggctcacacctgtaatcccagcact

 1.17 Intr +  14353  14489  137  1  2   83   49   182 0.970  14.01
tggctattgtcagcaaagtgaagtgacttgtaaaagataaaaaaaagctaagtggcaggg
cttggtccaaagcctggattccaaacctgggctgtttctccatacaaggggagcagggag
gcaggggcctggtggggcagggtgttgggcggtgtctcacagctgctctctgtgctccag
ACGCATCATGGGCTTTGTGAGTCGGAGCCAGGAGCGCCGGCTGCTGAAGAAGACCATGTC
TGGCACCTTTCTACTGCGCTTCAGTGAATCGTCAGAAGGGGGCATTACCTGCTCCTGGGT
GGAGCACCAGGATGATG
gtcagctgctctgccctgccattcccacagcctctcctttctgcctggctcccctcttgc
ccctctgcctgcccttggcttccctggctctgaactgaatccctcagctggtttgggact
gggcagccagagcagagagctccaaggcccggcctcttccctcaagcccgcctgttcctg

 1.18 Intr +  14684  14866  183  0  0   79   81   279 0.979  26.06
cctgccattcccacagcctctcctttctgcctggctcccctcttgcccctctgcctgccc
ttggcttccctggctctgaactgaatccctcagctggtttgggactgggcagccagagca
gagagctccaaggcccggcctcttccctcaagcccgcctgttcctgcattcactctccag
ACAAGGTGCTCATCTACTCTGTGCAACCGTACACGAAGGAGGTGCTGCAGTCACTCCCGC
TGACTGAAATCATCCGCCATTACCAGTTGCTCACTGAGGAGAATATACCTGAAAACCCAC
TGCGCTTCCTCTATCCCCGAATCCCCCGGGATGAAGCTTTTGGGTGCTACTACCAGGAGA
AAG
gtgggaatcgttgacatacttcattgctagattgcagagatctaccagacatccatagat
cccactccttcctttaaagcatgggaaaactgatatctagaggaattaagggattcgtcc
atgggatactgctggttactatggggatgagactgccaggaccatctgcactaggggaac

 1.19 Intr +  15105  15162   58  1  1   77   66    42 0.996  -1.16
atcccactccttcctttaaagcatgggaaaactgatatctagaggaattaagggattcgt
ccatgggatactgctggttactatggggatgagactgccaggaccatctgcactagggga
acctcaggctatatgtctggcccactgatcttctctgcttcttgtatatgttcctcacag
TTAATCTCCAGGAACGGAGGAAATACCTGAAACACAGGCTCATTGTGGTCTCTAATAG
gtgagatatgaactcttcattcatcctccctaatcctttttggctctgcttcagtgaatc
gtcaaaagggggcattaccttctcctgggtggagcaccaggatgatggtcagctgctctg
ccctgccattcccacagcctctcctttctgccttctcctaagctgccctattccagtctc

 1.20 Intr +  17173  17483  311  1  2   67  106   159 0.984  11.56
ttaggccacttgcctaaggtcccccagccaggattcaaactccaggaggcctgattccaa
acccatgctctttagccctccgccctactgccttcttagactagcttctgcttattctac
cattcctgatttcatttgaaccactgagccctgcccctttgtctgtctttgggtatccag
ACAGGTGGATGAACTGCAACAACCGCTGGAGCTTAAGCCAGAGCCAGAGCTGGAGTCATT
AGAGCTGGAACTAGGGCTGGTGCCAGAGCCAGAGCTCAGCCTGGACTTAGAGCCACTGCT
GAAGGCAGGGCTGGATCTGGGGCCAGAGCTAGAGTCTGTGCTGGAGTCCACTCTGGAGCC
TGTGATAGAGCCCACACTATGCATGGTATCACAAACAGTGCCAGAGCCAGACCAAGGACC
TGTATCACAGCCAGTGCCAGAGCCAGATTTGCCCTGTGATCTGAGACATTTGAACACTGA
GCCAATGGAAA
gtaagtgatgagatggagctatggaagatggcacacattccctttcctacctcttctccc
tctcccattacagaaaaagctgaactccaagctcctcattggagagaggtccattctgtg
attcctttttttaggaattacacatgccttcccccacctccctgctctttcatcccacaa

 1.21 Term +  17777  17919  143  0  2   42   49   126 0.960   2.19
ttctgtgattcctttttttaggaattacacatgccttcccccacctccctgctctttcat
cccacaagttcccactcaggctcttcccaggcctttcctgccatcctccctccctttccc
tgctgggttgggaactcctaactaagatcggggcctcacttttctctctggattacctag
TCTTCAGAAACTGTGTAAAGATTGAAGAAATCATGCCGAATGGTGACCCACTGTTGGCTG
GCCAGAACACCGTGGATGAGGTTTACGTCTCCCGCCCCAGCCACTTCTACACTGATGGAC
CCTTGATGCCTTCTGACTTCTAG
gaaccacatttcctctgttcttttcatatctcttgcccttcctactcctcatagcatgat
attgttctccaaggatgggaatcaggcatgtgtcccttccaagctgtgttaactgttcaa
actcaggcctgtgtgactccattggggtgagaggtgaaagcataacatgggtacagaggg

Predicted peptide sequence(s):


>STAT2_1|GENSCAN_predicted_peptide_1|812_aa
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQEQGEPVLETPVESQQHEIESRILDL
RAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKE
VLDASKALLGRLTTLIELLLPKLEEWKAQQQKACIRAPIDHGLEQLETWFTAGAKLLFHL
RQLLKELKGLSCLVSYQDDPLTKGVDLRNAQVTELLQRLLHRAFVVETQPCMPQTPHRPL
ILKTGSKFTVRTRLLVRLQEGNESLTVEVSIDSFRKFNILTSNQKTLTPEKGQSQGLIWD
FGYLTLVEQRSGGSGKGSNKGPLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNM
NQLSIAWASVLWFNLLSPNLQNQQFFSNPPKAPWSLLGPALSWQFSSYVGRGLNSDQLSM
LRNKLFGQNCRTEDPLLSWADFTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMG
FVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSL
PLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVS
NRQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTL
EPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNG
DPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDF