GENSCAN 1.0	Date run: 15-Jan-104	Time: 03:53:07

Sequence RPLP0_1 : 6804 bp : 49.34% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1529   1582   54  1  0   89   97    24 0.937   4.70
gcacgccccgagatgacggccgctgccctaggcagggccggcgggcgattgcgcgtgtcc
tgctcctcttaggcccgggaccgcgggatgggtgtcggcgtgaccaggcctgagctccct
gtctctcctcagtgacatcgtctttaaaccctgcgtggcaatccctgacgcaccgccgtg
ATGCCCAGGGAAGACAGGGCGACCTGGAAGTCCAACTACTTCCTTAAGATCATC
gtaagtgcagggtgggtcgcctctgctcttcatgttgccccagcgcaaatagggacagtc
agctgctatgtgctgagggtctactcacaccggctactgaattaggccatttttgggaaa
atactgtttagttaacaatttcctgagataggtcccttctgttgcagataaacgggctca

 1.02 Intr +   2827   3002  176  0  2   87   26   302 0.982  22.64
acccagctagccaatcatccagtttggcagtgttacaacgtagctcccaatctccctctg
acttcaaaagcttagaagaaagggagtgggatggaaacaaattgtggggttcagtttctt
ctggcattttttccctctctcttcctgttaaacttggctcctctggcttgttttttgtag
CAACTATTGGATGATTATCCGAAATGTTTCATTGTGGGAGCAGACAATGTGGGCTCCAAG
CAGATGCAGCAGATCCGCATGTCCCTTCGCGGGAAGGCTGTGGTGCTGATGGGCAAGAAC
ACCATGATGCGCAAGGCCATCCGAGGGCACCTGGAAAACAACCCAGCTCTGGAGAA
gtcagttcccctggcagttttgtcctttctccccagtgcccgtctccctcttcctggaga
atggtgctgaaaggtgattgtctcccataaacttctctttgcagactgctgcctcatatc
cgggggaatgtgggctttgtgttcaccaaggaggacctcactgagatcagggacatgttg

 1.03 Intr +   3107   3194   88  2  1   90  116   127 0.999  15.67
tggtgctgatgggcaagaacaccatgatgcgcaaggccatccgagggcacctggaaaaca
acccagctctggagaagtcagttcccctggcagttttgtcctttctccccagtgcccgtc
tccctcttcctggagaatggtgctgaaaggtgattgtctcccataaacttctctttgcag
ACTGCTGCCTCATATCCGGGGGAATGTGGGCTTTGTGTTCACCAAGGAGGACCTCACTGA
GATCAGGGACATGTTGCTGGCCAATAAG
gtaaggggacaattgggttggctaaagagactttgttgttgctccttaaagcaaaatgga
ccattctcaggttgtgtgagtggagaggcttttctcactgtttgttgtctttgtcaggtg
ccagctgctgcccgtgctggtgccattgccccatgtgaagtcactgtgccagcccagaac

 1.04 Intr +   3312   3458  147  2  0   83  105   101 0.999  11.73
gtgggctttgtgttcaccaaggaggacctcactgagatcagggacatgttgctggccaat
aaggtaaggggacaattgggttggctaaagagactttgttgttgctccttaaagcaaaat
ggaccattctcaggttgtgtgagtggagaggcttttctcactgtttgttgtctttgtcag
GTGCCAGCTGCTGCCCGTGCTGGTGCCATTGCCCCATGTGAAGTCACTGTGCCAGCCCAG
AACACTGGTCTCGGGCCCGAGAAGACCTCCTTTTTCCAGGCTTTAGGTATCACCACTAAA
ATCTCCAGGGGCACCATTGAAATCCTG
gtgagtggacctggtttgcctgtgctaaccaggcaaatggggagctgcttttagtggcca
tggatctgctggttgtccaacaggtgtttactgccccactattatctggttcagagtgat
gtgcagctgatcaagactggagacaaagtgggagccagcgaagccacgctgctgaacatg

 1.05 Intr +   3573   3758  186  2  0   36   61   312 0.975  23.19
aagacctcctttttccaggctttaggtatcaccactaaaatctccaggggcaccattgaa
atcctggtgagtggacctggtttgcctgtgctaaccaggcaaatggggagctgcttttag
tggccatggatctgctggttgtccaacaggtgtttactgccccactattatctggttcag
AGTGATGTGCAGCTGATCAAGACTGGAGACAAAGTGGGAGCCAGCGAAGCCACGCTGCTG
AACATGCTCAACATCTCCCCCTTCTCCTTTGGGCTGGTCATCCAGCAGGTGTTCGACAAT
GGCAGCATCTACAACCCTGAAGTGCTTGATATCACAGAGGAAACTCTGCATTCTCGCTTC
CTGGAG
gtatatgctgtcagccttgccccctcttacactgatggttgagagcatgacaaggttcag
actgagtccctgtaaccaaggactgtgttttcatctgtctacctacctcatctgtaaaat
gtcagtaacaacataagattgttgaaggattttttttttttttttttggagacagagtct

 1.06 Intr +   4850   4990  141  1  0   84   93   181 0.839  18.75
ttatttgatggggctgaattgctctgccaggagcatttggtatgagatgaaatggcctct
cttgagactgagctgccaacctggcaattattgtctgctaagggttctctttattcaccc
ttacttggacttcctttcctgtagggaatctcacgtaaaatgaaatcttccctcccccag
GGTGTCCGCAATGTTGCCAGTGTCTGTCTGCAGATTGGCTACCCAACTGTTGCATCAGTA
CCCCATTCTATCATCAACGGGTACAAACGAGTCCTGGCCTTGTCTGTGGAGACGGATTAC
ACCTTCCCACTTGCTGAAAAG
gtaaaaggatcccaccaggaccacagtgggcctgactgtgacaaattagcagggtgatgt
ggccttctaccttactgcttttatagttgtattttatatagcagataattttgtgagggg
atatttgagaggttgggaggcagggaaggcgtttctcacttgagaaatgacaagagaccc

 1.07 Term +   5378   5539  162  1  0  141   37   234 0.999  21.54
ggccttaggaaccctgcctcactaggccatacccaagctgtcctgcttgggctgcttctg
acaggaaaggcttcacacggactttgatattgttggtccttaaactctaccaaggcagga
gggtggtgggtaatagaggagtgtggatgaccattttgaccacttcccccctcctttcag
GTCAAGGCCTTCTTGGCTGATCCATCTGCCTTTGTGGCTGCTGCCCCTGTGGCTGCTGCC
ACCACAGCTGCTCCTGCTGCTGCTGCAGCCCCAGCTAAGGTTGAAGCCAAGGAAGAGTCG
GAGGAGTCGGACGAGGATATGGGATTTGGTCTCTTTGACTAA
tcaccaaaaagcaaccaacttagccagttttatttgcaaaacaaggaaataaaggcttac
ttctttaaaaagtctctggactcttaattttgtaattttttttcctttttgacacagggt
ctggctgttgcccaggctggagtgtggtggtgtaatcataactcactgcacccttgaact

Predicted peptide sequence(s):


>RPLP0_1|GENSCAN_predicted_peptide_1|317_aa
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTM
MRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE
VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI
SPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHS
IINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEA
KEESEESDEDMGFGLFD