GENSCAN 1.0	Date run: 15-Jan-104	Time: 03:39:27

Sequence PTPN11_1 : 90065 bp : 43.42% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +  28745  28867  123  2  0   83   97    50 0.894   5.10
agggaaaggcagggaggaggcattgaccaaggagaagagggggaagggacagggaaggtc
ttgatttgtattttctaaaattttctactctgctcataatgcgtcttagctgtgttgttg
tggaaagtagtgctgacagtgtcttgtttttttattacttactttgtctttctttttaag
ATGGTTTCACCCAAATATCACTGGTGTGGAGGCAGAAAACCTACTGTTGACAAGAGGAGT
TGATGGCAGTTTTTTGGCAAGGCCTAGTAAAAGTAACCCTGGAGACTTCACACTTTCCGT
TAG
gtaagttggaatgaaaagagaggatcctgagagtgttttctaggtaggaagtggtaaaac
catgcttggatagcttgctgcctgcatttcgagtttgaaggccttatctgagccctgggc
tgccttcagggtttggggagtggcctcctggacatttagcagaagaggagtaaggagggc

 1.02 Intr +  32787  32981  195  0  0   43   86   213 0.963  15.13
tgttgagttggttgacatgtggttatttcacccatcgtatttcttatagggaataggtaa
attcgttccttgggtttctttcaacacttaggtaaaatccgacgtggaagatgagatctg
attttactggtgtaactctttatttgtccccttgcctccctttccaatggactattttag
AAGAAATGGAGCTGTCACCCACATCAAGATTCAGAACACTGGTGATTACTATGACCTGTA
TGGAGGGGAGAAATTTGCCACTTTGGCTGAGTTGGTCCAGTATTACATGGAACATCACGG
GCAATTAAAAGAGAAGAATGGAGATGTCATTGAGCTTAAATATCCTCTGAACTGTGCAGA
TCCTACCTCTGAAAG
gtcagtaacattttagtgaccacaaagtctgctgctcccttgtgccctgagtgtcagaaa
tgcatgacggtctgtgtatgactctctgactccaaaggcttgtgactgttttttgagctg
taatctttaaagaattactaaagtgagactaatagcatcaaattattttcagagtacctt

 1.03 Intr +  35664  35856  193  0  1   49   99   172 0.999  13.89
tttttcctgcctgcatgggatgcagattttctgtctcaggtgggattgatcaatcccttg
gaggaatgtgtctactttttaattgtgtttaggagagctgactgtatacagtagttttgt
gaaagaacaacatgaacccatagtagagctaaattcttttttattttttaaaaactttag
GTGGTTTCATGGACATCTCTCTGGGAAAGAAGCAGAGAAATTATTAACTGAAAAAGGAAA
ACATGGTAGTTTTCTTGTACGAGAGAGCCAGAGCCACCCTGGAGATTTTGTTCTTTCTGT
GCGCACTGGTGATGACAAAGGGGAGAGCAATGACGGCAAGTCTAAAGTGACCCATGTTAT
GATTCGCTGTCAG
gtaaatctccagttgaaaaatgggtctggcaagatgttacctttgggtgatttttctgct
gacagaagacagacaccattacattcaaagtcagattgtcttttatttatttatttattt
atttatttatttgagacagggtcttgctctatcacctacagatggggtttcaccacgttg

 1.04 Intr +  37033  37149  117  0  0   49   99   129 0.998  10.76
tgctggaattactggcgtgagccactgcacccagcctattatctgtcttttgatggacat
ttaagttgtctctatatactagctattgtgaataatgctgcagtgaacatgagagtgctt
gaaaacactaatgtaacataaaggtaacaaataataaatgtcatgtgtttatcttgaaag
GAACTGAAATACGACGTTGGTGGAGGAGAACGGTTTGATTCTTTGACAGATCTTGTGGAA
CATTATAAGAAGAATCCTATGGTGGAAACATTGGGTACAGTACTACAACTCAAGCAG
gtgagcagattggaaagctcaagctttctccttaaaaacttaaaacaaatcctaatagag
aattttgcaaacatacagaggtagacagaatagtatcatcagcctccatgtacccattgc
agcttcaactatcaaatctttttttttttttttttttttgagacagtcttactctgtcac

 1.05 Intr +  38419  38532  114  0  0    7  107    62 0.591   0.64
ctgaacagaaaacacggtgaaacgatttgaaaacttttattgtgaattacagggtcctat
gaaccctctgtccgtgcctttatgaatatcaacatagacatgtttttttttttttttttg
cattaacaccgttttctgtaatattttctttattttacatcaactgctgtactcgatcag
CCCCTTAACACGACTCGTATAAATGCTGCTGAAATAGAAAGCAGAGTTCGAGAACTAAGC
AAATTAGCTGAGACCACAGATAAAGTCAAACAAGGCTTTTGGGAAGAATTTGAG
gtaagttattaaaaaactgtttttacgtgagttgttatatcctatttttagtggaggaga
agttgctcttgtgtttggaattggacctgagagacttgaaactgacgtccttttttaatt
cggccattgattgacacggagcaagttgctgagagggcttcttcgaaacagaagagcatt

 1.06 Intr +  55413  55509   97  2  1  142   95    41 0.997   9.78
gtgtggggattacaggtgtaagccatcacgcctgacccagatgaacattcttgtagctat
cgcacacaattctgaacatttcctaggatgaattccttaaagaagtaatgctgatccagg
cttttttctttttctgtgactctttgacacgtaataatattgacttttctttctttccag
ACACTACAACAACAGGAGTGCAAACTTCTCTACAGCCGAAAAGAGGGTCAAAGGCAAGAA
AACAAAAACAAAAATAGATATAAAAACATCCTGCCCT
gtaagtatcaatattccgctcagtaatagtcactcttggagattttgattcctagcacct
ctgtacctttcctcagggtcgtgtgctcttgttagcacatcggaggccttagcttcttta
attgcaagcagtttccaaaataatcaaccatggtgggtgttgatgacttcattcactgag

 1.07 Intr +  60120  60199   80  1  2  123  103    74 0.999  11.67
tttgagacatcaggcagtgttcacgttactgttttgcttacctgggctttaatttttatg
tgtttttttttcaatcattgaatgaacaaaacttggactaggctggggagtaactgattt
gaactgttttttcctgaagcagtccaggacttatgtgaccgtggtctctttttcttctag
TTGATCATACCAGGGTTGTCCTACACGATGGTGATCCCAATGAGCCTGTTTCAGATTACA
TCAATGCAAATATCATCATG
gtaagctttgcttttcacagtgttttctgaccatacatttctagcctatttttgtatttt
aaatccttcctcatgtcctgaaagtaactttaaggtgtttgaaggattttcttcctaaat
ttctagcctgaatttgaaaccaagtgcaacaattcaaagcccaaaaagagttacattgcc

 1.08 Intr +  60326  60484  159  1  0   36   94   152 0.993  10.78
gatggtgatcccaatgagcctgtttcagattacatcaatgcaaatatcatcatggtaagc
tttgcttttcacagtgttttctgaccatacatttctagcctatttttgtattttaaatcc
ttcctcatgtcctgaaagtaactttaaggtgtttgaaggattttcttcctaaatttctag
CCTGAATTTGAAACCAAGTGCAACAATTCAAAGCCCAAAAAGAGTTACATTGCCACACAA
GGCTGCCTGCAAAACACGGTGAATGACTTTTGGCGGATGGTGTTCCAAGAAAACTCCCGA
GTGATTGTCATGACAACGAAAGAAGTGGAGAGAGGAAAG
gtaaatcacagaaacttcttttctgctaaactgtttttaaagtatcagacatgtcagatt
ggccatgtttaggaattgaataaatgaattaagcttactgtaactgattctctggaaaaa
agggactaggagaaatttgattatgttattccttggtgtagttttctttatgtttcttct

 1.09 Intr +  64543  64674  132  0  0  101  108   160 0.981  20.14
gaatgcctgcttttcttatttgaactcttctgtccttttctgaaaacctaacagatgcga
aacaggccattttccatgttggtggttattaagcaagacttgaacatttgtttgttgctt
gtttaggcttttatttcagagttcacagaattaactttctttttttctgatctcttccag
AGTAAATGTGTCAAATACTGGCCTGATGAGTATGCTCTAAAAGAATATGGCGTCATGCGT
GTTAGGAACGTCAAAGAAAGCGCCGCTCATGACTATACGCTAAGAGAACTTAAACTTTCA
AAGGTTGGACAA
gtaagtatattgtcgtattctagagactttgggaactgttgatggtgtgtaggaattcag
ggtcttgccgttactcatgtttgcatacatgcatgcattcgctcactcattgattcagta
gccatttattagcttccttctatgtgccaggtacagtttaagcagtactggtacattgtg

 1.10 Intr +  68944  69098  155  0  2   59   61   203 0.999  13.57
gttgcctccaggattgcccaaaaggagacgagttctgggaacctcacgaagaggaccttt
cagtggaacctggggagattctcttcctctccattggatttaggaaagcttagaaccggg
tgattcctcaacctcttgatttatttaattcttttctggtttttcttggctctactccag
GGGAATACGGAGAGAACGGTCTGGCAATACCACTTTCGGACCTGGCCGGACCACGGCGTG
CCCAGCGACCCTGGGGGCGTGCTGGACTTCCTGGAGGAGGTGCACCATAAGCAGGAGAGC
ATCATGGATGCAGGGCCGGTCGTGGTGCACTGCAG
gtgacagctcctgctgcccctctaggccacagcctgtccctgtctcctagcgcccagggc
ttgcttttacctacccactcctagctctttaactgtaggaagaatttaatatctgtttga
ggcatagagcaactgcattgagggacattttgatcccaaggcatatttctcctagaccct

 1.11 Intr +  70912  70979   68  1  2  118   98    95 0.966  12.05
gtttgggctgactccaaagccctatgctttttgccaacatattttcaaacataaatagac
aattttataaatagctccaaagagtagacattgtttctgttgatattaatggcttggttt
tgagtctgaaacccccatgaatgattctgttgtccctgctttttgtccttctgcccgcag
TGCTGGAATTGGCCGGACAGGGACGTTCATTGTGATTGATATTCTTATTGACATCATCAG
AGAGAAAG
gtgggtcatctggtgggcaagaagcgacagtttctgtttttagtttatggaaggaaagtg
ctcacgaaaacagtctggggaagagaggttgaatgggaaaattctttcacaaaaatctgg
gctgaagacttcagtgtgtctgcctgagaacagaagtgacactatttgagcttttggcat

 1.12 Intr +  71493  71644  152  1  2   93   81   178 0.961  17.48
tagtcttctgggatcattggtattggtcagaagttcaacactgtagccattgcaacatgc
tcagttaaaacagcaaagactaaattagcattgtctctgagtccactaaaagttgtgcat
taaacaacttcatcctggctctgcagtttctctttattcttcatgatgtttccttcgtag
GTGTTGACTGCGATATTGACGTTCCCAAAACCATCCAGATGGTGCGGTCTCAGAGGTCAG
GGATGGTCCAGACAGAAGCACAGTACCGATTTATCTATATGGCGGTCCAGCATTATATTG
AAACACTACAGCGCAGGATTGAAGAAGAGCAG
gtaccagcctgagggctggcatgcggattctcattctcttgctaggcctcttggatacgc
tctccttttgagcaggaggacaggctctgatagacaactgtttgatttcggaatgggaaa
caaactcccaactaaaagggcctctggaaactgtcaattattctccacttctcagctctg

 1.13 Intr +  83771  83803   33  1  0  130   98   -15 0.458   2.12
aacattagataatgatgctcatctgatggattagattttcagagttggctgtttccaggt
gcctataggagtagaaaagggtgacaaacctcctaactagatgtcctaccaaatatagtt
cactccacatctgagatgagactgcatgactgctggttttctttgccttttcccccccag
GGTATCATCAGAACCAAAAATAAAGTTTTAAAG
gtgggtcaggtgtgtgttggctcatgcctgtaatcctagcactttgggaggctgaggcag
gtggatcatctgagctcaggagttcaagaccagcctggctaataacatggttaagcccca
tctctactaaaatacaaaaagttagctgggcatggtggtgggcacctgtaatcccagcta

 1.14 Intr +  84613  84725  113  0  2   67   89     9 0.383  -1.92
atttaccttgagaaggtgaatcccctaacaatttggtcaatgtatcagtattctcaaccc
gtctatcaatttttttttctttctccctcttttttctttttttgggcaaaataccttttt
tgctttttatccccttaaaataaccattgtccctcacatgtgcactcttccaaatttcag
AAAAGCAAGAGGAAAGGGCACGAATATACAAATATTAAGTATTCTCTAGCGGACCAGACG
AGTGGAGATCAGAGCCCTCTCCCGCCTTGTACTCCAACGCCACCCTGTGCAGA
gtaagtagtgctgaaggaaattctttttacctggtcatggtggtttaaaaaggtttaaaa
aacaaaaacaaaaacaaaacacaagtttgtagcacatgcctttcactggtgcacgttcct
gttgccctactgttagtgtatctgtgactggtgatatctattgattgtgttaatgctatc

 1.15 Term +  87164  87233   70  2  1  127   54    55 0.480   3.41
attatattgctgtatggctatctcttctctccctgggaatgtcaggtcctaggcacagga
actgtgtctgtaccatatctggtgcccaaagaatgtagtatgtgttttatagatatcatg
taagcttaaacagcgtggtctacatttttgtaaatgtctttctttttcttttctctccag
AATGAGAGAAGACAGTGCTAGAGTCTATGAAAACGTGGGCCTGATGCAACAGCAGAAAAG
TTTCAGATGA
gaaaacctgccaaaacttcagcacagaaataggtatttaaatgcaagtgctctattggtt
aattgtttatataattggcagtatttttaagcaggcaagcaatttgggaatgttttagca
aagtgtaccataattgagttttacaaaccaggctcctttttcctctccctgtacttcttt

 2.02 PlyA -  88618  88613    6                               1.05
 2.01 Term -  89469  89402   68  1  2   10   43   225 0.995   8.30

Predicted peptide sequence(s):


>PTPN11_1|GENSCAN_predicted_peptide_1|600_aa
XWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYD
LYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEK
LLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGG
ERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVK
QGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDY
INANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGK
SKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRTWP
DHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGV
DCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQGIIRTKNKVLK
KSKRKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR

>PTPN11_1|GENSCAN_predicted_peptide_2|22_aa
XKTIIIIIIIIIIIIIIINRGK