GENSCAN 1.0	Date run: 15-Jan-104	Time: 03:53:53

Sequence PLA2G1B_1 : 8073 bp : 45.86% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1237   1270   34  0  1   64   96    58 0.851   2.51
atcccatgctggcaaatcgtcagggtcattcctgcaacagacagattcaaggccagcccc
aaactcagccaagagcaaagcaaacactccagccttatctgggcagggttgtgtggagac
tgactataagactatacctgagactggtcatctcagttcttttctcaccttgactgcaag
ATGAAACTCCTTGTGCTAGCTGTGCTGCTCACAG
gtaggcaagtctccccggctccacccgcctttctctcccaagtgagctaagatctcactc
ctctggaatgggggccacaggccacagcaaacagggatggccagccccgcagtctcaatt
cgaggttcccagtggggcttaagggctcctctattggggttccctcaaggctggcacttt

 1.02 Intr +   2970   3129  160  1  1   81  108   349 0.884  35.25
ttaaaaaaaaaaaaaaacctctacccactttcactttaccaggttcctgggtccaacggt
cttcagaggaggcagctggcaggggtcagggaggcagcgtgggacccgagggagcaggaa
ggcagtgtgtccccggggtgctggcagaccgatttgaactctggctatgtcttcttgcag
TGGCCGCCGCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCA
AGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTACGGCTGCTACTGTG
GCTTGGGGGGCTCAGGCACCCCCGTGGATGAACTGGACAA
gtaagtgatccgcctgcaggaaaattggagtgcctgccgggggcggggtggggcacacgc
caaggatctcacgaggcatacaaaggggacttgcatatctgctaaggataacatattttc
acctcttgtcaaataaacaaatatgttccaagaggaccctgtagcgaacgcaccccgtta

 1.03 Intr +   3929   4056  128  2  2  101   42   161 0.996  13.12
aaaaaaaaatgctttcaataaatatatgataaaaggacttatattttttcaagccatagg
atcatttctcctgaagcatcttggcgaagtcatccccacctgttcctgagagtgggcagg
tgagggctgacctattgctctgcacttactcctatctcagctgtccctcccactttccag
GTGCTGCCAGACACATGACAACTGCTATGACCAGGCCAAGAAGCTGGACAGCTGTAAATT
TCTGCTGGACAACCCGTACACCCACACCTATTCATACTCGTGCTCTGGCTCGGCAATCAC
CTGTAGCA
gtaggtttatcccttccttgacctatgaattctagttggttctcagtaggccggggggaa
ataatagtaacaacagccatgatttagtgttaattttcttggttctgggcagtgtctcct
ttaatcctcagaacaacactatgggataggtacaattatcctcacttaacagataagaaa

 1.04 Term +   6673   6797  125  2  2  114   42   185 0.999  15.05
tgtttatctgaaagtcaaatttaactgggcatcctgatgtacttgtattcacttaatctg
tcagccctaaatgtgcatcagtggaatggctgccagcttattccagttaattcttcttgc
cccagattgtacaaaacagggtccaccttggctcagtcctctcctttcatccctctccag
GCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTGCGACCGCAACGCTGCCATCTGCT
TTTCAAAAGCTCCATATAACAAGGCACACAAGAACCTGGACACCAAGAAGTATTGTCAGA
GTTGA
atatcacctctcaaaagcatcacctctatctgcctcatctcacactgtactctccaataa
agcaccttgttgaaagacctcatgtttggatattgttttattctctgtctataaactagg
tctctgcctactcttttatttttatgtatttattttttctaggtggagtcttgctctgtg

Predicted peptide sequence(s):


>PLA2G1B_1|GENSCAN_predicted_peptide_1|148_aa
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS