GENSCAN 1.0	Date run: 15-Jan-104	Time: 04:59:59

Sequence PDE1B_1 : 32019 bp : 49.60% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1441   1566  126  1  0   96   84   156 0.845  15.79
ggcagcgggagaggaggagccgcaggagctgcagctctgccagcttgggccgagcctaga
gacaccggcctggctggtccacgccagccgcaggtgggaagggcctgggatggggggtga
gggtctctcggctggggctgaagctgagccgaggtgctgtctcctccttctgttccgtag
ACCGTGGCTGAGCATGGAGCTGTCCCCCCGCAGTCCTCCGGAGATGCTGGAGGAGTCGGA
TTGCCCGTCACCCCTGGAGCTGAAGTCAGCCCCCAGCAAGAAGATGTGGATTAAGCTTCG
GTCTCT
gtaagtccccggcccgggaatggggggaagggaccttagggagcctgagcgggaggagga
ggggggataactggagcagggctgtgggctggtagattctctttggcacagatgttggca
ggtgcgaggaagcacggccctgacacgcgtggccaggccacatgtgcaaggcatgtgcgg

 1.02 Intr +  18555  18668  114  0  0  115   93   187 0.995  21.46
agtggcaatagcctgagattaaaaaagaaacattagctgctattattattaatgttagaa
tgattaactatttacaaaagactgaggatgtttctgtaaaatgtaccttattagggagta
tgctgttctcatgataaggtagctgtgcctaagcagcctctctgtatctgctccctgcag
GCTGCGCTACATGGTGAAGCAGTTGGAGAATGGGGAGATAAACATTGAGGAGCTGAAGAA
AAATCTGGAGTACACAGCTTCTCTGCTGGAAGCCGTCTACATAGATGAGACACG
gtgagagagaccgacagacagagaaggagaaagatgtcagacatagtgttccagagagag
gggttaagacaaagatagacacatgtggcatggacagagaccggaagaaagagagagggt
ggaccagatataaagagctctaggtagtggctcacacctgtaatcctagcactttggagg

 1.03 Intr +  20765  20947  183  2  0   75   89   358 0.999  33.50
tttcattattggagatgttagataaagaaataaaaagatatagagaaagaaaggaaacag
ggttgaagacagagagctggcatgagagttactaaatgtggggtatggctgggtacaggg
tctctaggctgtggaagcacctgctgtctttcctctgtgactccccttctggggtctcag
GCAAATCTTGGACACGGAGGACGAGCTGCAGGAGCTGCGGTCAGATGCCGTGCCTTCGGA
GGTGCGGGACTGGCTGGCCTCCACCTTCACCCAGCAGGCCCGGGCCAAAGGCCGCCGAGC
AGAGGAGAAGCCCAAGTTCCGAAGCATTGTGCACGCTGTGCAGGCTGGGATCTTCGTGGA
ACG
gtgaggctcgcccacactcagcctccctctgcctttagctgtgcccctctttcccagcca
ccctggtcttccatgaccaccagccatatgatcccatggctcatccccacatccccagct
ggccacacctccactcccagaccttcatatgtgggcttcttctcattgttctctctcagg

 1.04 Intr +  21127  21193   67  1  1  106   84    30 0.948   3.31
ggtgaggctcgcccacactcagcctccctctgcctttagctgtgcccctctttcccagcc
accctggtcttccatgaccaccagccatatgatcccatggctcatccccacatccccagc
tggccacacctccactcccagaccttcatatgtgggcttcttctcattgttctctctcag
GATGTTCCGGAGAACATACACCTCTGTGGGCCCCACTTACTCTACTGCGGTTCTCAACTG
TCTCAAG
gtaatctctgggtttttgggaaagaggagaaagttaggggatggaatagccactgggact
tctagaccctgtttatggcattatttttgccttccttttttttttttgaaatggagtctc
gctcttgtcactcaggctggagtgcagtggcgtgatctcgtctcactgcaacctctgcct

 1.05 Intr +  21822  21938  117  2  0   86   53   102 0.960   7.16
caaactcctgccttcctgtctctcccatactgagagatatatgggaagaaagaggcacac
tttaccatttctttgctttcctatttaccaagactttgtactcatgggaagtccttcttg
aagtctaacttcaacccttgctgctgctggaaagccacataatctattgtttctccatag
AACCTGGATCTCTGGTGCTTTGATGTCTTTTCCTTGAACCAGGCAGCAGATGACCATGCC
CTGAGGACCATTGTTTTTGAGTTGCTGACTCGGCATAACCTCATCAGCCGCTTCAAG
gttgggcagcatcctacctctacctccaggcaggattctccactcctctcatgcctgttc
taaaagcctcccaacaaacagattccatagatcccctcactcagtctcaacatcagggaa
gtctccccatgcccacgcccagcctagcctttctttcacttgctgcagtcttagttccag

 1.06 Intr +  24182  24322  141  1  0  106   66   170 0.995  17.15
cccaaggttgcacagccagcaggtggtagaggcaggatatgagccaggttcacctaacta
ggttctgtgctctctccctatgccacactgccttctaaagaaagttgttgatctcggtcc
gtaatcaccaccattcctgtggatccttgatatatctccatttcccctaactccccgcag
ATTCCCACTGTGTTTTTGATGAGTTTCCTGGATGCCTTGGAGACAGGCTATGGGAAGTAC
AAGAATCCTTACCACAACCAGATCCACGCAGCCGATGTTACCCAGACAGTCCATTGCTTC
TTGCTCCGCACAGGGATGGTG
gtaggtgccctggagatgattcttctgtgattcagggcctatggctacagaactgggagg
tctagactgtactcccatttccatttctcctcgttggttcttcttgggcactccaaagcc
ttgacagagccaaactggattaactcactctagagaattcccaggtagactaaaactcgt

 1.07 Intr +  24729  24829  101  2  2  118   61   208 0.999  20.01
ggttcggatggaggaaggtccttggccatttcaggagctgagaaacctggctgcattaac
caagagctggcctggaagcatggaagggatgggatgagtgatctagcctgtgtgtggagg
ttcctgggaagtgaccagcaggcgtcacccctctctcattctttctctttcctcctgtag
CACTGCCTGTCGGAGATTGAGCTCCTGGCCATCATCTTTGCTGCAGCTATCCATGATTAT
GAGCACACGGGCACTACCAACAGCTTCCACATCCAGACCAA
gtgaggggtggggatgtggcaggggcaggaggggccaagaggaggtggggaggttgccgg
agtccctccttacagggggtggtcatgatgacctttggctttgtaggtcagaatgtgcca
tcgtgtacaatgatcgttcagtgctggagaatcaccacatcagctctgttttccgattga

 1.08 Intr +  24936  25061  126  0  0   76   30   205 0.998  13.29
gccatcatctttgctgcagctatccatgattatgagcacacgggcactaccaacagcttc
cacatccagaccaagtgaggggtggggatgtggcaggggcaggaggggccaagaggaggt
ggggaggttgccggagtccctccttacagggggtggtcatgatgacctttggctttgtag
GTCAGAATGTGCCATCGTGTACAATGATCGTTCAGTGCTGGAGAATCACCACATCAGCTC
TGTTTTCCGATTGATGCAGGATGATGAGATGAACATTTTCATCAACCTCACCAAGGATGA
GTTTGT
gtgagcagaagccagtacttggcatccctaagagactcccttaccacaaactccattttc
cacttcctggacctcctgcccagcagcgctgaggggactgattgcttctctttttatgtc
cgctcagagaactccgagccctggtcattgagatggtgttggccacagacatgtcctgcc

 1.09 Intr +  25189  25290  102  1  0   86   23   122 0.652   4.79
atgcaggatgatgagatgaacattttcatcaacctcaccaaggatgagtttgtgtgagca
gaagccagtacttggcatccctaagagactcccttaccacaaactccattttccacttcc
tggacctcctgcccagcagcgctgaggggactgattgcttctctttttatgtccgctcag
AGAACTCCGAGCCCTGGTCATTGAGATGGTGTTGGCCACAGACATGTCCTGCCATTTCCA
GCAAGTGAAGACCATGAAGACAGCCTTGCAACAGCTGGAGAG
gtggcatctggtggggtgtggctggggccaggccagagggaggggtgtgtgaactggggg
ggtatacacaagggtagttggtgtgccaggtctttacctcgctgtagagactccactggc
ttcaggtatcagactgcatctctatgtgagagagagagagagtgtgtgtgtgtgtgtgtg

 1.10 Intr +  26679  26799  121  0  1   72   74   148 0.989  12.30
tgagctgagattgtgccactgcactccagcccgggcaacagagtgagaccctgtctcaaa
aaaaaaaaaaaaaaaaggaagaagttatgtgatagggtgtgcgtgggaagttagggaatg
gtcctaacttccttttcctaaaagatcagtctcccttcccttgccatctgccccaaccag
GATTGACAAGCCCAAGGCCCTGTCTCTACTGCTCCATGCTGCTGACATCAGCCACCCAAC
CAAGCAGTGGTTGGTCCACAGCCGTTGGACCAAGGCCCTCATGGAGGAATTCTTCCGTCA
G
gtagcgtggcatctttgccttccctgtgcctatgggggccttctctccccttttgccctc
caagttccccaatcctgttccacatcctccttttgctacctgtagtctctgacctgatcc
caaatccttggggtaaaaccccattatcctaaaagcctaacaatagttgcatttcatttg

 1.11 Intr +  27013  27081   69  0  0   79   82    27 0.599   0.58
gggggccttctctccccttttgccctccaagttccccaatcctgttccacatcctccttt
tgctacctgtagtctctgacctgatcccaaatccttggggtaaaaccccattatcctaaa
agcctaacaatagttgcatttcatttgcatatatttcatttgcatattactaatttccag
GTCAACAGTGCAGAAATTTCACACAACAACCCCCCACCCCCACCACTTGCCACCTGTACC
CCAGATCTG
gtaggtctgaggtatcctctccagctttcctaccctgttccctcctctagggtgacaagg
aggcagagttgggcctgcccttttctccactctgtgaccgcacttccactctagtggcac
agtctcagataggtgagtgtcctctcctgcaggaaggggaggactgggagggggaaaaga

 1.12 Intr +  27132  27213   82  2  1  117   95    24 0.999   5.21
aagcctaacaatagttgcatttcatttgcatatatttcatttgcatattactaatttcca
ggtcaacagtgcagaaatttcacacaacaaccccccacccccaccacttgccacctgtac
cccagatctggtaggtctgaggtatcctctccagctttcctaccctgttccctcctctag
GGTGACAAGGAGGCAGAGTTGGGCCTGCCCTTTTCTCCACTCTGTGACCGCACTTCCACT
CTAGTGGCACAGTCTCAGATAG
gtgagtgtcctctcctgcaggaaggggaggactgggagggggaaaagatgctgcctgggt
caggattgctccaagtcctcaatccccccaaaccattcttcctgtagaggaaagcctact
gtgctagagcatggggtcctgggttaggaggccagggggctgcaatggcaggaaggagct

 1.13 Intr +  27573  27681  109  1  1   70   94   190 0.981  17.14
tctctggggcaccaagacatcatcccaaagcctgccctgcattgggaagttttcagcccc
aggttacctctccatcctctttcataagcagccaggggtcctggccatgccagctgcatg
ctctgcctagccctccagataatagtaagacatctctacggcattgctcctccactgcag
GGTTCATCGACTTCATTGTGGAGCCCACATTCTCTGTGCTGACTGACGTGGCAGAGAAGA
GTGTTCAGCCCCTGGCGGATGAGGACTCCAAGTCTAAAAACCAGCCCAG
gtgagggtggctggggtagccagatatcttggttcaggaaggcagtggtagggagggatt
tggactcacagagaggaccgactcacagccatggtggggtggtggggaggcagactgctt
caagcttgggagtccctctgccgtcagggacagaaggatgggatcagaagggtgtgacct

 1.14 Intr +  28152  28282  131  0  2   59   52   146 0.995   8.44
ggaggggtgaaatgagggggagagggacagggacttggggaatatctagtagaggaaaag
aggaagatgaagttccctgaaccttctcctggtcttccatgtcctgcactcccagggcta
aggtggttctggagtgggctggggcttacctcttgcggcttttgggggttctgcttctag
CTTTCAGTGGCGCCAGCCCTCTCTGGATGTGGAAGTGGGAGACCCCAACCCTGATGTGGT
CAGCTTTCGTTCCACCTGGGTCAAGCGCATTCAGGAGAATAAGCAGAAATGGAAGGAACG
GGCAGCAAGTG
gtgggtaccatggcagagggcaggggtgagaacttgtgtgggtggatcatggagcactag
gaggtccatttttcttaagcccctggggaaaccctttgccggactccttgatttgggagt
ggagctgatcagaccagttagatcacaggaaagactggctgagtggcctggaatgttcta

 1.15 Term +  28806  28909  104  1  2  117   41   205 0.999  17.14
gagggttctgagttttagcaaggctggagaggctcttcccaagtggggatgggttgaatg
tagttcagcttgaaggcaggttgatggatgagaatcccttacatgtctccacatactcct
tgggttctggggaagaatacttcttggcctaagctcagcctcctttatgctcctctacag
GCATCACCAACCAGATGTCCATTGACGAGCTGTCCCCCTGTGAAGAAGAGGCCCCCCCAT
CCCCTGCCGAAGATGAACACAACCAGAATGGGAATCTGGATTAG
ccctggggctggcccaggtgagcctgttgtggtggagggtgtaggagagctggtgtctat
catggcatctttgttgggtcgtctctgggctccagtggatgcgacattctctctcccctt
ttgagcagtaaaatggagcgagtgaagacatagaatggagccaaagtgtgggtggagcag

 2.02 PlyA -  29333  29328    6                              -0.45
 2.01 Term -  29542  29408  135  1  0   92   49   159 0.982  10.42

Predicted peptide sequence(s):


>PDE1B_1|GENSCAN_predicted_peptide_1|564_aa
XPWLSMELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEE
LKKNLEYTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRR
AEEKPKFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAA
DDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTV
HCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENH
HISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLER
IDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQVNSAEISHNNPPPPPLATCT
PDLGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPLADEDS
KSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDE
LSPCEEEAPPSPAEDEHNQNGNLD

>PDE1B_1|GENSCAN_predicted_peptide_2|44_aa
VGCFFHDHAPLEQMGEPVLMDGADDIKHFGLNEDLGKEGETSVP