GENSCAN 1.0	Date run: 15-Jan-104	Time: 04:12:12

Sequence NTN4_1 : 135353 bp : 40.14% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1650   1704   55  2  1   99   94   141 0.949  15.32
gcggtcccggcccctggctcccagctgccggcgaccgctgaccgagcccggcgccccagg
aggaggaagaaaccagggccccgttccctcccgaggacggcggcgcttcatcccgcagcc
cagaggtctcggctccctccggcacccgcccggcccggctgctcccggctcctcccggcc
ATGGGGAGCTGCGCGCGGCTGCTGCTGCTCTGGGGCTGCACGGTGGTGGCCGCAG
gtgggtggtgacgcggcggggcccccaccccttccctcgctgcttctctaacccatctcg
ggactcgggggtgcaggggagccagggctgcgagcgcagagcgctgctcccgagggtgaa
atgagtggccatgttccgcctcctttccccggggctccgcagtttcaaatactattgatt

 1.02 Intr +   4491   5020  530  1  2   84   94   506 0.815  42.53
gtgaatgcagaacagtgttcatgctcaaacaggaacatggtggagcatggtagaatttgc
catttatcgaaagtctcaagcgcttttggggagatccttgactgttgttgatggactagg
tggccaaaagagctttccagatgggtttgtcttgcatcatgcatgctttccctttcttag
GACTGAGTGGAGTAGCTGGAGTGAGTTCCCGCTGTGAAAAAGCCTGCAACCCTCGGATGG
GAAATTTGGCTTTGGGGCGAAAACTCTGGGCAGACACCACCTGCGGTCAGAATGCTACCG
AACTGTACTGCTTCTACAGTGAGAACACGGATCTGACTTGTCGGCAGCCCAAATGTGACA
AGTGCAATGCTGCCTATCCTCACCTGGCTCACCTGCCATCTGCCATGGCAGACTCATCCT
TCCGGTTTCCTCGCACATGGTGGCAGTCTGCGGAGGATGTGCACAGAGAAAAGATCCAGT
TAGACCTGGAAGCTGAATTCTACTTCACTCACCTAATTGTGATGTTCAAGTCCCCCAGGC
CGGCTGCCATGGTGCTGGACCGCTCCCAGGACTTTGGGAAAACATGGAAGCCTTATAAGT
ACTTTGCGACTAACTGCTCCGCTACATTTGGCCTGGAAGATGATGTTGTCAAGAAGGGCG
CTATTTGTACTTCTAAATACTCCAGTCCTTTTCCATGCACTGGAGGAGAG
gtaagggcacctgtttaactctacactgtaagtaagatagaaaaatgttaccagcccgca
tttttttttaaagcatgaagctatacttgtagcaacatgaatgaaattagaatttttcat
gagatttatttgtcataaattatttcttacccttacatatgaatgtgtagtcattttcaa

 1.03 Term +  10521  10592   72  2  0   59   47    68 0.026  -3.27
ccaacttttaagtgcaggggtacatgtgcagcatgtgcaggtttgttgcataggtaaatg
tgtgccatattggtttgctgcacagatcatcctattgcccaggtattaagcccagcatcc
attagctattcttcctgatgctcgccctcctcccacccaggtttgctatttttaaaacag
ATTGAAGGATTTGTGTTTGATAGAATGGACAGTGACAAGGACTATGAGTTCCTGGCAAGT
TTTCATGAGTGA
acaaaacctataattaagggtcacatttgctttatggtaatggtatggttttttaaattt
ttttattatactttaagttctagggtacatgtgcacaacgtgcaggtttgttacatatgt
atacatgtgccatgctggtgtgctgcacccattaactcgtcatttacataaggtatatct

 2.02 PlyA -  11414  11409    6                              -0.45
 2.01 Sngl -  12652  12041  612  1  0   82   41   225 0.460  13.14
 2.00 Prom -  13813  13774   40                              -9.55

 3.02 PlyA -  13870  13865    6                               1.05
 3.01 Sngl -  15755  15462  294  2  0   88   54   335 0.997  25.55
 3.00 Prom -  29009  28970   40                              -4.25

 4.01 Init +  38970  39038   69  2  0   84   80    33 0.024   3.20
caattaggcctggtggaactgccgtcaataaatcaagcgttatcagggtgaggaacagga
aagaatgaaatatggggaaatggggtgaatatcaggtggatcagagaaatacagtcatgg
gggtcaggtgtggtatcaggaataatgtgggaggccagattgaagtccggaccaggaaca
ATGGTCATTGTGGGACTTAAAGAGCGAGCACAGCTGAAGGAGCCGGGGAGCAGAAAGTAT
ATGCATCAG
gtatgaggaagaaaatagattttggaagctatgagaaatgtagagagtgagttgagcata
gtttgtgatttttagggcctctaacagtattaaagcagcggcagccgctgcacgcagaca
tgagggctaggctaaaacagtaaggtcaagttgtttggacagaaaggctacacggtgtgg

 4.02 Intr +  40279  40397  119  0  2   25  109   137 0.026   7.84
ggggagttttaagaggtttagaagcctggctgtcaatacccataacagttatggaggcaa
gggaaacaggcccttgaaaagaaggtaatgtggagtgggtagcctccgtatagattaaga
aggggacggccttaccttccactgtgagttacctgaagcttggcgtccgtgatggtctag
GGGGCTTCCGAGGTGATCGGGCAGTGTCGGTCTTCAGCCGCTAAGCCGAGAAGATCTGGG
AAGGAGTCAGTCAGAGAGCCTTGGGCCAGAGTTCCAGGGGCTCTGGGAGTGGCTGCCAG
gtgagttgaacagtccgattttcagtggggtcccacacagatgggatgcggcttaggagg
aatcccgggctgcgggcattccttggcccagtggccagatttccagcatatgtagcaagc
tcctgtgggaggaggttctggaggaacgcctggccgctgcggttcaggcgtttggaagtt

 4.03 Intr +  49084  49246  163  1  1   88   38   129 0.534   6.96
tgctactgaagagaagaaatccataaagcattttgaaatgtattacatatttttacatag
tgtttatacatagatgtgtgtgttcacatcgttctcatcaagagtgcggaacttgtggta
agagcatcttgctatctgtgttcttctaaactctagaccctgtttggcttctcctcttag
AATGATACTTGGAGAAATAGTTGATTCATTTATTCATTCAGCAGTCATTATGAAATGCTA
CAATGTGCCAGAGACTGTGGGACATGCTGGGGAGCACAGCTGTGAACCAGACAAACAGGA
TCCCTGCCCTCTGAGCACTGAGTCTGATGTGAGATACAGACAA
gtaaataggcaacaacaatagaacagtgtaagtgtgccatcatggaaggaacgagttcca
agggagtccacaggacggccttgaatattattcctcaagctagcagctaaaaagaatttt
taaaaatatgatcacatttattattacaaatttttataattcaacataggcaatacaatg

 4.04 Intr +  53815  54093  279  0  0  116   78   327 0.461  31.25
tctgctccttagaataacagggcggctctgtcccaggtgtgctcaaggtctaaaaacttc
ttgttatcttatcgttcacagatgacataaggcataaatcaaacagggactacattaggc
aaacaattcagggtttgcgcacagtcctataaacgcatggtattttctttctccttacag
GTTATTTTCAAAGCTTTGTCACCACCATACGATACAGAGAACCCTTACAGTGCCAAAGTT
CAGGAGCAGCTGAAGATCACCAACCTTCGCGTGCAGCTGCTGAAACGACAGTCTTGTCCC
TGTCAGAGAAATGACCTGAACGAAGAGCCTCAACATTTTACACACTATGCAATCTATGAT
TTCATTGTCAAGGGCAGCTGCTTCTGCAATGGCCACGCTGATCAATGCATACCTGTTCAT
GGCTTCAGACCTGTCAAGGCCCCAGGAACATTCCACATG
gtaggtgaaacaagtcctcccctaagaaaaacaaatcataagttaccttcagctttgggc
attggttggtatatgcttaacatagtgctgctgattttttcctctgcccatcacagctcc
gactccatactcatcctataaagtgcctgttaacttgtcttttaatcttcagttttagag

 4.05 Intr +  78621  78747  127  2  1   87  100    79 0.170   8.33
ttcaaaagatgataagacaaactaaagaaagcatctctcctcttgatggctaacttcttc
aggaaagtgaatgaacatcttatgactaaagccaatccatgagattagattgtgggaagc
atgttctgttcttctttggcgacatgtgtgctcatagttctcacttgatgttgcttgtag
GTCCATGGGAAGTGTATGTGTAAGCACAACACAGCAGGCAGCCACTGCCAGCACTGTGCC
CCGTTATACAATGACCGGCCATGGGAGGCAGCTGATGGCAAAACGGGGGCTCCCAACGAG
TGCAGAA
gtaagtaacaagcccacgatactcaaaagctttctttgtaaagtcaacgcatctgtggac
tccttgttgtctctagaaatacaacacaaagtggtgggtgacaaacactagaccctacac
aaacatagccatatcactgcccactgaggcttcagccactgaaaacagttgccgttcatt

 4.06 Intr +  81330  81518  189  1  0   67  111   128 0.169  11.64
ctggtctcaaactcctggcctcaggtgatccacctgcctcagcctcccacaagtgctggg
attacaggtgtgagctaccacgcctggccaactcatcctatttttacctatctgaatatg
agataacccatcattttatttttacttattagtgtttctctccacgcttcttatttccag
CCTGCAAGTGTAATGGGCATGCTGATACCTGTCACTTCGACGTTAATGTGTGGGAGGCAT
CAGGGAATCGTAGTGGTGGTGTCTGTGATGACTGTCAGCACAACACAGAAGGACAGTATT
GCCAGAGGTGCAAGCCAGGCTTCTATCGTGACCTGCGGAGACCCTTCTCAGCTCCAGATG
CTTGCAAAC
gtaagtaacctgtggtttccagaaaataggctgatttgtacaagagatgaatctctttat
ccctcattctgctaacccaaaagaaggaggtcattgaggttctgagataacacactcaca
gatatcggttaatttcttcattgataagaggcaagaattttcaaccagttgggtgaaaac

 4.07 Term + 108250 108467  218  2  2   93   42   189 0.695  11.12
atctcgcttatctgtcatttaattagctttcattctctgagcatacactcactggctaaa
gaaggagtctcagaaatatgctgtgtggtgaagggaagccacttggggatggtcaagcct
aatgttcacacgggtgatctacagtcagtctttgatccttgcgtgtcctctctgttgtag
CGTGTTCCTGCCATCCAGTAGGATCAGCTGTCCTTCCTGCCAACTCAGTGACCTTCTGCG
ACCCCAGCAATGGTGACTGCCCTTGCAAGCCTGGGGTGGCAGGGCGACGTTGTGACAGGT
GCATGGTGGGATACTGGGGCTTCGGAGACTATGGCTGTCGACCATGTGACTGTGCGGGGA
GCTGTGACCCTATCACCGGAGACTGCATCAGCAGGTGA
atgtgcaaggctcttgctctcagctgcatgtatttcaggctcttttgaaaacctatagtg
atttggaaaatcttgcattctgttaatggagcaaagatgtatttgcacatctcttttaaa
gaatttttgtcaggctgggcgtggtggctcacgcctgtaattccaacactttgggaggct

 5.04 PlyA - 110464 110459    6                               1.05
 5.03 Term - 119256 118893  364  2  1   59   49   426 0.648  28.85
 5.02 Intr - 119443 119310  134  1  2  -28   32   115 0.365  -7.18
 5.01 Init - 119656 119585   72  1  0  122   72    90 0.683  11.94

Predicted peptide sequence(s):


>NTN4_1|GENSCAN_predicted_peptide_1|218_aa
MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATEL
YCFYSENTDLTCRQPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLD
LEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAI
CTSKYSSPFPCTGGEIEGFVFDRMDSDKDYEFLASFHE

>NTN4_1|GENSCAN_predicted_peptide_2|203_aa
MAIRQEKEIKRIQLGKEVKLSLFADDMIVYLENSIVSAQNLLKLISNFSQVSGYKINVRK
SQAFLYTNNRQTESQIMSELPFTIVSKRIKYLGIQLTRDVMDLFKKNYKPLLNEIKENTN
KWKNIPCSWVGRINIVKMAILPKVIYRFNAIPIKLPMTFFTKLEKTTLKFIWNQKRACIA
KSVLSQKNKAGGITLPDFKLYYK

>NTN4_1|GENSCAN_predicted_peptide_3|97_aa
MGKKQRRKTGSSKNQNTSPPPKERSSSPATEQSWMENDFDELREEGFRRPNFSELKEEVR
THRKEVKNLGKRLDEWLTRITNVEKSLNDLMELKTVA

>NTN4_1|GENSCAN_predicted_peptide_4|387_aa
MVIVGLKERAQLKEPGSRKYMHQGASEVIGQCRSSAAKPRRSGKESVREPWARVPGALGV
AARMILGEIVDSFIHSAVIMKCYNVPETVGHAGEHSCEPDKQDPCPLSTESDVRYRQVIF
KALSPPYDTENPYSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIV
KGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTAGSHCQHCAPLYNDRPWEA
ADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCDDCQHNTEGQYCQRCKPGF
YRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPCKPGVAGRRCDRCMVGY
WGFGDYGCRPCDCAGSCDPITGDCISR

>NTN4_1|GENSCAN_predicted_peptide_5|189_aa
MAAYKLVLIQHGECMEPGDPLQQLMPLIRCGPPVMRTWRLNERHYGGLTDLGKAETAAKH
GEAQVKIWSNISKDRRYADLTDDQLSSCESLKDTIASALPFWNKEIVPQIKEGKWVLIAA
HGNSLRGIVKHLEGLSEEAIMELNLLTGIPIVCKLDKSSKPIRCMEFLGDEGTLCKAMEA
VAAQGKAKK