GENSCAN 1.0	Date run: 15-Jan-104	Time: 04:03:34

Sequence LIN7A_1 : 142869 bp : 36.83% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Sngl +   1402   2154  753  0  0  114   43   384 0.957  30.40
catctggctaccaacccacccaagctttcttctccaccaccaccaccttccttccttccc
cctcctccccctcctttccgtcttccctctccacccccgcccccaatctcctcctttttt
tctcactacgagcggttgctgatgctgaagccgagcgtcacttcggctcccacggcagac
ATGGCGACATTGACAGTGGTCCAGCCGCTCACCCTGGACAGAGGTAAGGGAGCGGCTCGC
TCGCCAGGCCACCGCGTCCCCTCTCCCCTCCTCCCTTCCCCGCCTGCCAATTCCCAACGG
GACATGGGACGCGCTCAGGCAGGAGGAGAAGGGGAACGAGGACGAGCCAGGAAGGCGTTC
GCGCCGAGAACAGAACACTTTCTTCCCCTTTCTCTCCCCGCTACGTTCCCGCTGCCCCTT
CCCACTGTACTCGCCCCGCCGAGGGGACGCCTCCTTCTGGCTCTGGGGTCCCCGCTGCCA
CTCCCAGCCCCTCGCCGGGTCGTCTCCGGTCCTCTGGCTTTGTTGGAGCCGCTGCGCGGG
GACGGCTATAGGCGCCAGGGGCTCGGGGTTGGAGAGGGGCAGAGAGCAAGCTCGCCCGGC
CAGAGCCCAGAGGAGACCGGCGAGGGAGCCGCCTGTCAGCTTGCTTGGCGCAGGGGCCCG
GGAGGAAGGAAGTTTGTCCAGGCGCCGGAGGGCGAGGGTCGGTCCAACTGCTGGAGTCCC
GGCGGCCACTCGGGGGGCGGGCTGGGCGCACCCCTGGGCTGCCGGGCGCACAGTGGCGGG
GCTGCAGCAGGCAGGGAGCTGCCCTCTGCCGAAAGGGCAAGGCAGAGCGCGGGGAGCCGA
GCCCCAGCAGCCGAGATCGGCTCTCCGCGGCTTCGAGATCGAAAGCGGCGAGGGTCGCGT
CTGCTCCCGCCGCCGGCAGCTCCCGGTCGATAG
caactctcggcttctcccgcgccagcctctcgtgtcctctcccagctcggtgccaccgcg
gcgcccaggctgcggaaggcgcggggacaaagcgcaggtcgggttaaaattcaacttctg
acctgccacccagtgagtcctgctctctgacttgaacggggaaagtgttcgcttcctccc

 2.01 Init +  15366  15425   60  2  0   81   75    51 0.693   4.40
caaaatacaaaacattatttgtattttgaagaattgagaattgaggcataaagaggctaa
acaaagaggaatggagctcggtctggttgattcttgagaacttaagcttaaccactagac
tatactatcaacagcaagtgcataggtcagtaatagaatctatagcaagctctgaggaac
ATGAACTTGCAAGGAACAATTGAGGCACAGGTGCTTGCAAAGACTTCAAAGAACAGACAG

gtagaaggcacaccaggagagtatgttgtatgagaaaaaaaggaaggaactttgtacaat
gcttacaaaaggaacttacatagcaatgttggtaaagcaatttaaaaatgtaatatattt
ttaaggtccagcacaattattgaaaaatagcagatgttaaataaatgattgtgcttatta

 2.02 Intr +  19469  19581  113  1  2   66   70    57 0.161  -0.04
ctgcctttctttggtctgccagactaaattcagccttctgtctatggagagtcttgtgtg
ggagagttccctgcccctttccagtggtaggaaatctataacaatatacatatactatca
aaggatttcaggactaggactgtttcctgccctctctttcccaccccattcctgggatag
AGGGTTTTTGGCTTTTATCCTTCTCCCCGTTGTAATGGGTCTACACCTCTTGTTTTCCAC
CCTGATCTGTTCTTTCTAGGAAGCACCCGGTGGAAGTTTGTGGAAAAAAATCA
gtgagtgcttgccactctcaaaggttatatactcatccctgctcacagttggcccttcct
gaatttgttaaacattttagctggatttttctcacttatttggaatagtactcactgtct
cttcttcccaagctctcccacaggtcagggagcctgtgttcactttccaactcctcttag

 2.03 Term +  36193  36598  406  1  1   56   33   192 0.355   4.17
ttgaggtatgtttcttcaatgtttgttgactagatattgaagaaacacacctcaaaataa
taaaagctatttatgacaaacccacaaacaacatcatgctgaatgggcaagaggtcaaac
cattcttgagaactggaacaagataacaccacccactcttactgctcctactcaacatag
TACTGGATGTCCCAGCCAGAGCAACAGGCAAAAGAAAGAAATAAAAGGGATCCAAATAGT
AAAAGAAGAAGTCAAACTATATATCTTCAGTGACAATATGATTCTATACCTAGAAAATCC
TAAAGACTCTGCCAAAAGTCTCCTAGAACTCATAAATGACTTAAGTAAAGTTTCAGGATA
CAAAGTCAATGTACAAAAACCAGTAGCCTTTCTATACACCAACAATGTCCAGACTGAGAG
TGAAATCAAAAACACAATCCCACTTACCATAGCCACAAAGAAAATGAAATACCTAGGAAT
ACAGCTAACCAAGGAAGCAAAAGATCTCAACAAGGAGAACTACAAACCACTGCTGAAAGA
AATCAGAGATGGCACTAATAAATGGAAAAACATCCCGTACTTGTAG
attggaagaatcaatataaaaatagccatagtgtccaaagcaatttacacattcatttct
attcgtctcaaactactaatgacgttcttcacagaattagaaaaaaactattctaaactt
caaatggaaccaaaaaagagcccaaatagccaaagcaatcctaagcaaaaagaacaaagc

 3.01 Init +  39851  40139  289  1  1   49  -28   180 0.118  -0.18
acataaatgcaaaaatcctcaacaaaatgtaaacaaactaactccagcatcacatcaaaa
agttaatccatcacgatcgaaaaagctttatccttgggatgcaaggttggttcaaatgta
cacaaatcaataaatgtgattcaccacataaacagaactaaaaacaaaacccatatgatc
ATGTCAATAGATGTAGAGAAGGCTTTTGATAAAATTAAACATCACATCATGCTAAAAACC
TCCAACAAACTGGGCATTGAGGAAACGTACTTCAAAATAATAAGAGCCATCTATGAAAAA
CCCACAGCCAACATCATACTAAATGGGAAAAAGCTGGAAGCATTCCTCTTGAAAATGAGA
AAAAGACAAGGATGCCTTATCACCACTCCTACTCGACATAGTACTGGATTAGCCCGAGCA
ATGAGGAAAGAGAAAGAAAGAAAAGGCATCCAAATTAGGAAGAGAGGAA
gtcaaactatccctgtttacagactatataattctatacctagaaaaccccatagactgt
gtgcaaaagctctttgatctgataaacaacttcagcaaaatttcaggatacaaaaacaat
gcgcaaaaatcagtggcatttccatacaccaacaacattcaagctgagagccacatcaag

 3.02 Intr +  49716  49834  119  1  2   79   64   124 0.945   8.36
aacaaattaaaatgactttttaccaaaagatgagaccaaaaagctatgaatataagttct
gattatgcaatttaagtccacttgcttttcaatgtcatcatccaactggaataatagtac
tttcagctgatgagatacaatttattctaggtttctctattttcattttttttcattcag
ATGTTGCAAGAGCAATTGAATTACTGGAAAAACTACAGGAATCTGGAGAAGTACCAGTGC
ACAAGCTACAATCCCTCAAAAAAGTGCTTCAGAGTGAGTTTTGTACAGCTATTCGAGAG
gtatggcactaaaattttaataactaaattcagccatatgtcttcttcatagaaaacatg
tcttctctacacaaacagttgaaattgttaagattggaactacattttaattttctgttt
ttagctacttggacagatgataaaatataatttagcctgctaaattagatccagccagga

 3.03 Intr +  54443  54505   63  1  0   51   84    75 0.018   1.40
atgtcataatcaccaagaactgccttctttggctaatcaccaaattgaatgttagtattt
tctaaagtagtagaagtatagaataagaaaataaatcaaccctatatggaatgactgtca
ttttgtgataataggatttcaaaactgggtcagttctctacttctttgtgcatgctacag
TTGAATTTCTCCGTCCTATCTAAAGCTATCTATGGTTATGATAACTGCTTTAGCCAATCA
CAT
gtgagtggaagaagctatatgttccacttcttcatgggagcctatgaataagtaaatgat
ttgccatgttctcttccttttgctagacgactagtaatgttttatatgataaattatcaa
tcagtctggtttaagaacgagaaaataaaaaatagagactctagataaccttttatgaac

 3.04 Intr +  76926  76978   53  2  2   46  119    23 0.928  -2.01
agtccttattttcaatataatcaattgaagaaaagaggtcagacctaggtatacagttgt
atcacataaaaggttaagatccataattttaaaggattcctggaaattgtgaaatatgat
gaaactctttttgcaggctttacagattaccaaattgtgactcactctctgttcggttag
TATAAGCTGAAGGACTTGGTGATAGTTGAGACAGTTATAACCTCAACTATCTG
gtaagttctttggaaaataaccaagtcatctatttctctatttagagatctattttgagg
gtcacacaactattatcttaaaagtcttcaaatgattctaataccatcacattgatgatg
gctcctttaaaataatctaaaagaatatttaattagtggggaaagtgttcacaatatttt

 3.05 Term +  77953  78481  529  1  1   50   54   316 0.715  17.14
gagcaacaccctgcagggaaggacgactgaaactcccgagatactccacatcaccgggaa
caaaatgaagaggcaggcaccaaagtgttgtgcaaggagcactatcggatcctgaccctt
ttctgtgaggaagacctagaggtgtgacgtctcctgtgtactcagccctctgaccaccag
GGTCAGTCACCACTTGAGGCCCAGAGAGAAAGCTGCCTCTCATCACCAGAAGAGGCTCAG
CAGTTACATTAAGTCTCTGGAAAGGAAAGTTGTAGACAGTGCAAAATTAGTAGCCACTCA
AGATAGAAAACCTTTACAACTGAGAAATAGGGTGAAAAACCAGATACAGACATCCTTCTC
TAAATGTGAGCACCTGAACATATTTGCGGATCATGAGCAAGAGGCAGTTCTCTCAAGGTT
AGTTGATGAAGAGAAGAATATTCAAAAGAAACTTAATGCAAAGATAGCATTTTCAGATGA
CATTTCCACAATCAAAGATCTACTAAAGGAGGTGGCAGAAAAGAGTGTCATGTCAGAAAT
GAAAGTGCTGCTGGGCATCAAGAGTATCTGCAACAGGCATGAACGCCTGAAAACTTCAGC
TCTCTATTCACTCCTGTGCAGTTTATCCAGTTGCTCTGGGTTCCAGAATGATGTAGTTTA
TCCTGTTGTTCTGGGTTCTGAAGACTTTGATTCCTGCCAGCATTACTGA
gaggctgaagtggtccattcaccaccctgaattaactcttgagggctgtaaagactccct
cttcaggaaaggaaagtgatctctatcagaacagacagatgctggacaacggagctacag
aatggtaactctgttgcttgaagcactattttagtcatccttctgctaaaggaaaaggcc

 4.01 Init +  82041  82124   84  2  0   80   69    65 0.423   4.67
ctctgaatctaagatatctggcttggcctagaaggtggaatataaaatgagaagactagc
tgtatcggctccaagcaggtacccccacctaagttctcgtgacatggatgcagaaagaga
agaaggtgtatctcacagagccaacctttgagagacactatcaataccactagtaaagcc
ATGACCTTGTACAGTTCCTGCATGCTGATCAACCACACGGGCAGATCTTCCTTCCATAAG
GATATTGGGGCAACTAATAAACAG
gtgtgcagaggctaaattgtgtgccaatgggcaggaagtttttaatcccaaagtatcacg
tttgcatcacatttgttttcaatcgtcaaattcagtggagtttttgttttgttttgtttt
gtttttagttataagtattgccatcctattaataacttggttgtcagatacatcttgtca

 4.02 Intr +  93146  93355  210  1  0  100   68   159 0.945  13.29
gaaagaaatcctagatggcatctaaatgaagaaagtcctctgctttttgtgttctttctt
tcacaggagaatactataaaaatatgagaagttgcctgagctacccactgcaaagcatat
gattagcctttatttccctcattttattaccaaaagaccatctttttttttttttttcag
GCAACAGTTGCAGCTTTTGCAGCTAGTGAAGGCCACTCCCACCCTCGAGTAGTTGAACTG
CCAAAGACTGATGAAGGCCTTGGTTTTAATGTGATGGGAGGAAAGGAGCAAAATTCCCCC
ATTTATATCTCTCGCATAATTCCTGGAGGGGTGGCTGAAAGACACGGAGGCCTCAAAAGA
GGAGACCAGCTGCTATCAGTGAACGGAGTG
gtatgtttataaaataaccagagattttctccttaagcacattctttttttttgccccct
gctattactgaagtcaacgttgaaaacctagaataaatattcattttatgtctaaccagc
tttctaagcattgatggatattaaacctataaaagctgcaatctaatttttatgtctcat

 4.03 Term + 127402 127620  219  0  0   73   43   415 0.914  31.56
acctgcttatagtttaaccacaatgtaataaataataacgatgatggtaagataactcat
ttgccatgttttcttaaaattttaaattttgggttcttaatgtgatattaatttcagatt
tgtctccagggaaaagaacattgaacctcctccctttaagaagtgtcattgtattttcag
AGTGTGGAAGGAGAACACCATGAGAAAGCTGTGGAACTACTCAAGGCTGCTAAAGACAGC
GTCAAGCTGGTGGTGCGATACACCCCAAAAGTTCTGGAAGAAATGGAGGCTCGCTTTGAA
AAGCTACGAACAGCCAGGCGTCGGCAGCAGCAGCAATTGCTAATTCAGCAGCAGCAACAG
CAGCAGCAGCAACAAACACAACAAAACCACATGTCATAG
gtgagaagtgacttattctatacaaggagtatatatatatatatacacacacacatatat
gtatatatgaatatacttaaaatatattttagatatgttctaaaatatattttcttagct
gaaacaaaatcattagatttaaataatccaaacaaaatcaatcaaacaaaagacagtgat

 5.01 Init + 133192 133239   48  0  0   68   43    44 0.839  -1.10
cagagtctctctctgtcacccaggctacagtgccgtggtgcgatctcagctcactgcaac
ctctgcctcctgggttcaagcgattctcctacctcagcctcccaagtagctgggattaca
gatgtgagccaccatgcccagactgaaaggcacgtcttacatggtctcagcaagagaaaa
ATGAGGAATAAACACAAGCAGAAACCCCTGATAAACCCATCAGATCTC
gtgagacttattcactatcacaagaacagcacaggaaagaccagccaccatgattcaatt
acctccccctgggtcccttccacaacacgggaattctgggagatacaactcaagttgaga
tttgggtggggacacagtcaaaccatatcagagtgttatatttattcagcttgaagcacc

 5.02 Term + 133735 133905  171  0  0  105   41   168 0.991  10.64
ccatggctagatctagggtggagaattcattccagtcaaaaccagcctgtatcttattaa
atttacaaagttgctggcatttgacagtagcctcaccaaatctctttttcctcccactct
aaagaccccccattttctttattttgcctacctttaaaacccttctctaccttcttctag
CATTACCACATGCATGATCCTGATGATCTAATCCAGGGAATTATTACGAAAACTATCCGC
CTAGTCACTAAGAAAACCAAGTTCCAGGGGATGACTCCAATAAAATCGAATGCAAGGAAC
CCAGAGTTTCCAAGCAGAACACCGGACAGAAATAATCATAAAGCTGACTAA
cacttattaaacaattagtgtgtgccaagaactcttttaagtgcctcatatatattaaat
tacttaatctttacaatagccttatgcagattaggtactatgtttaatcttgttttaaag
agtaaactaattagtacaaccactatggagaacagtttggaggttcccactgcagatatc

Predicted peptide sequence(s):


>LIN7A_1|GENSCAN_predicted_peptide_1|250_aa
MATLTVVQPLTLDRGKGAARSPGHRVPSPLLPSPPANSQRDMGRAQAGGEGERGRARKAF
APRTEHFLPLSLPATFPLPLPTVLAPPRGRLLLALGSPLPLPAPRRVVSGPLALLEPLRG
DGYRRQGLGVGEGQRASSPGQSPEETGEGAACQLAWRRGPGGRKFVQAPEGEGRSNCWSP
GGHSGGGLGAPLGCRAHSGGAAAGRELPSAERARQSAGSRAPAAEIGSPRLRDRKRRGSR
LLPPPAAPGR

>LIN7A_1|GENSCAN_predicted_peptide_2|192_aa
MNLQGTIEAQVLAKTSKNRQRVFGFYPSPRCNGSTPLVFHPDLFFLGSTRWKFVEKNHTG
CPSQSNRQKKEIKGIQIVKEEVKLYIFSDNMILYLENPKDSAKSLLELINDLSKVSGYKV
NVQKPVAFLYTNNVQTESEIKNTIPLTIATKKMKYLGIQLTKEAKDLNKENYKPLLKEIR
DGTNKWKNIPYL

>LIN7A_1|GENSCAN_predicted_peptide_3|350_aa
MSIDVEKAFDKIKHHIMLKTSNKLGIEETYFKIIRAIYEKPTANIILNGKKLEAFLLKMR
KRQGCLITTPTRHSTGLARAMRKEKERKGIQIRKRGNVARAIELLEKLQESGEVPVHKLQ
SLKKVLQSEFCTAIRELNFSVLSKAIYGYDNCFSQSHYKLKDLVIVETVITSTIWVSHHL
RPREKAASHHQKRLSSYIKSLERKVVDSAKLVATQDRKPLQLRNRVKNQIQTSFSKCEHL
NIFADHEQEAVLSRLVDEEKNIQKKLNAKIAFSDDISTIKDLLKEVAEKSVMSEMKVLLG
IKSICNRHERLKTSALYSLLCSLSSCSGFQNDVVYPVVLGSEDFDSCQHY

>LIN7A_1|GENSCAN_predicted_peptide_4|170_aa
MTLYSSCMLINHTGRSSFHKDIGATNKQATVAAFAASEGHSHPRVVELPKTDEGLGFNVM
GGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVK
LVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS

>LIN7A_1|GENSCAN_predicted_peptide_5|72_aa
MRNKHKQKPLINPSDLHYHMHDPDDLIQGIITKTIRLVTKKTKFQGMTPIKSNARNPEFP
SRTPDRNNHKAD