GENSCAN 1.0	Date run: 15-Jan-104	Time: 04:44:31

Sequence GPD1_1 : 8229 bp : 55.61% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1227   1267   41  2  2  116  107    31 0.993   7.45
cccctgtctctcctttccctggctctgccagactctctatctccctgggcgccagcctcc
ccacccacccctggagggcggggcttggctgcacccacgtgtggtggagttaaatgctcc
tagccggcagaggagctagggagtgtggcactgagccggctcaggcagagacgcggcacc
ATGGCTAGCAAGAAAGTCTGCATTGTAGGCTCCGGGAACTG
gtaagcagctctgtcaagtgatatgggggaagggtaggccccccaagacagaggtgggta
ggaggcagaatgggtgggaaaggccctcaggttcctgttcagcccctgctgctatcttct
atcatagcagcacaggacagacggtgcccggccctctcctgacccccgccctcctgggca

 1.02 Intr +   1750   1927  178  1  1  111   77   267 0.996  28.34
gagtctcctttctactgccaggtcactggggactatttgtcatgggagtggaggtgataa
ggaaggtaggtaggagtgaacagcctggggggctgctgtgagatcctgaggtggggcgct
gccccaactcctgccactgttccctcctcctgtactttcctgtgctccccctcccaccag
GGGCTCAGCCATCGCCAAGATCGTGGGTGGCAATGCAGCCCAGCTGGCACAGTTTGACCC
ACGGGTGACCATGTGGGTATTTGAGGAAGACATTGGAGGCAAAAAGCTGACTGAGATCAT
CAACACGCAGCATGAGAATGTCAAATACCTGCCAGGGCACAAGTTGCCCCCAAATGTG
gtgagccccaacaccctgcgaagaacagggagaggaagggagggccaggagttggagccg
accttactcaacaggtgcctcctgctgagagggccgcttcaggtgcagcaggacttggga
aggtctcaggagggctgctctgggccctttcctgaggactgaggagaacctatgctttcc

 1.03 Intr +   2724   2864  141  2  0   74   45   210 0.817  16.36
gctggggggagggagtagagtgtcttattcctccaagttcagtccttctagattcagtcc
caaacaagccttcctgctcccctaccagcctcactctttggctcccagatctcctgaata
gggttccacaggggctaggggaggtctgccaggcccgcgagcacttggtcacccccacag
GTGGCTGTCCCAGATGTGGTCCAGGCTGCAGAGGATGCTGACATCCTGATCTTTGTGGTG
CCCCATCAGTTCATCGGCAAGATCTGTGACCAGCTCAAGGGCCATCTGAAGGCAAACGCC
ACTGGCATATCTCTTATTAAG
gtgccagggacaccttcatgtggatgggggagggtgcggctcactgttgtggggttcagg
gtgggtgaagcaaggagaacagaaaatggcagacgcaggccaagagtttgctggagaaaa
gagaggcagttggctctggagaggcttaggaaagcagtgaggtgctgggggtcactggaa

 1.04 Intr +   3464   3602  139  1  1   45   77   267 0.990  21.84
aggacagttggtcacatgctgtctggcctcctcacagcaaacttgagctgggttggaatg
gggcaggacctgtcgggagggacacagatgagcaatggatttggaagggacagaatttct
gggcggaagcccgcaggtgggcccaaagggcacctggcctgagctccatcctgtgctcag
GGGGTAGACGAGGGCCCCAATGGGCTGAAGCTCATCTCGGAAGTGATTGGGGAGCGCCTC
GGCATCCCCATGAGTGTGCTGATGGGGGCCAACATTGCCAGCGAGGTGGCTGATGAGAAG
TTCTGTGAGACAACCATTG
gtgagagccccctggcacctgcatacacagtgcatctagttgcatcccctccccaaactg
ccccaaccccacttagccatctctttcccataaggcagagaaaggaaaatacaagcatca
gaggtgaaggaggctgggacacccccagggaaggggcttcagggcctgcttagggaaaca

 1.05 Intr +   3981   4093  113  1  2   98  100   133 0.928  16.10
cagagttggtgcagtggcacacctgtggtcccagctacttaagaggctgaggtgggagga
tcgcttaagcccaggagtttgagtccagcctgggcaacagagagagactcccatctctat
aaaataaatattttttaaaaagagtccttccctcaaagccttgccccctcctcactttag
GCTGCAAGGACCCGGCCCAGGGACAACTCCTGAAAGAGCTGATGCAGACACCAAACTTCC
GTATCACAGTGGTGCAAGAGGTGGACACAGTAGAGATCTGTGGAGCCTTAAAG
gtgagaggggcacagaggcagctatggggtgaggagaaggccccaaaggaggtctggctg
agctctgcaaggctgcaggtactccaggctctcactattgagcagtggttcccctttcct
accatgtcccatgcatataggaggagctgcagaagcaaggccagggccattcaggccggc

 1.06 Intr +   4743   4976  234  2  0   82   86   320 0.999  29.62
cttaagaaagggggtgcagcaaggggggaaaccaagaggcggaagtaggcttctaaaagg
ccacacactatacctctcttctgcagtgggtgtcacggctgatgaaatgagtatgagggg
gctccacatggggcctataggagggggtcttttctcacctatgacctccactccttcaag
AATGTAGTGGCCGTGGGGGCTGGCTTCTGTGATGGCCTGGGCTTTGGCGACAACACCAAG
GCGGCAGTGATCCGGCTGGGACTCATGGAGATGATAGCCTTCGCCAAGCTCTTCTGCAGT
GGCCCTGTGTCCTCTGCCACCTTCTTGGAGAGCTGTGGTGTTGCTGACCTGATCACTACC
TGCTATGGAGGGCGGAACCGGAAAGTGGCTGAGGCCTTTGCGCGTACAGGAAAG
gtgggccccgggagaagggagaacagaggggcggctctgtaggcatccaggtagaggtgc
ttggcgggaggcatctctggagcacaaacattaagactgttgtgcacatccccatccctc
ttttcctcccaagaccccactcccatctgagctccagtctctccaccccctactgacaac

 1.07 Intr +   5200   5306  107  0  2   68  108   135 0.899  13.01
catccaggtagaggtgcttggcgggaggcatctctggagcacaaacattaagactgttgt
gcacatccccatccctcttttcctcccaagaccccactcccatctgagctccagtctctc
caccccctactgacaacccttctctcccatttccatccactcatcctgttttctgcacag
TCCATTGAGCAGCTGGAGAAAGAGTTGCTGAATGGGCAGAAACTGCAGGGGCCCGAGACA
GCCCGGGAGCTATACAGCATCCTCCAGCACAAGGGCCTGGTAGACAA
gtaagtattggccacagccccactgattaagggagccacagccagaagtgctcgccctgt
tcatcatcttcctaaacctgccacaaatctgtgaagtggacagaaaggggagtattacct
tacatttcagacagagtccagagcttgcagagtctggcatgcccattgtccgccagctag

 1.08 Intr +   6599   6691   93  2  0   94   73   124 0.902  11.08
atctgaccttaaacctagggctagggagttcacattctcagaaggtagaaactcacagcc
atccttcctgagctccaaggtgggagggcaagggacaggagggttaggcagtgagtgggg
gtgggggtagagtggaccaggagtgggaggctaagctgagcctttccctctccaatctag
GTTTCCCTTGTTCATGGCTGTGTACAAGGTGTGCTACGAGGGCCAGCCAGTGGGTGAATT
CATCCACTGCCTGCAGAATCATCCAGAACATAT
gtgagtggggccagggcccaggccaggccgcttttttaccccagtggagaccagcagaag
cctggggtacctagtcaccaggatctccaggactcccagggagcagagtcttctcatctt
ttcactggaggacaggaggctatggggcccagctacgcacctggagatcctgaactgtca

Predicted peptide sequence(s):


>GPD1_1|GENSCAN_predicted_peptide_1|349_aa
MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHEN
VKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIK
GVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKEL
MQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
ETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHX