GENSCAN 1.0	Date run: 15-Jan-104	Time: 03:44:41

Sequence FBXW8_1 : 122592 bp : 43.28% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1283   1600  318  1  0   79  105   427 0.793  40.84
cggaccaccacgtgcgtacaggggcagcgccgggggcgtggcgggggcgtggacgcccac
ccggaaccctagagcggcggcggcagcggcttccggccgcggcggacacttccctgggcg
ggactgtctcgtggcacccggtggaaccgaggagaacgtggagcgccgggagcggcgaat
ATGGACGACTACAGCCTGGATGAGTTCCGTCGGCGCTGGCAGGAGGAGCTGGCGCAGGCC
CAGGCGCCGAAGAAGCGGCGACGGCCCGAGGCTGCCGAGAGGCGGGCTCGGCGGCCGGAG
GTGGGCTCCGGGCGCGGCGAACAGGCCTCGGGGGACCCGGCGCTGGCCCAGCGTCTCCTG
GAGGGCGCGGGGAGGCCCCCGGCGGCGCGGGCGACTCGGGCCGAGGGGCAGGACGTAGCG
AGCCGCTCACGTTCTCCTCTGGCCCGCGAGGGCGCCGGGGGCGGGGAGCAGCTGGTGGAC
CAGCTCATCCGCGACCTG
gtgagtggccgtcgcctcccccccgcccatgcctgcgccggcccccgcccccaggacaaa
cccctgcagtgatttggagagtaactgtgtgccactagttgcccgagaaaatgagtagac
gcacaaacaccaatgtttgtgcttgcataggggtctttctggaagcagcacttcccaacc

 1.02 Intr +  18268  18372  105  0  0  129  110    32 0.975   9.91
agattctgaaatagttccatgactgcctggtgaaacagtatggatgcctccctcctggga
aacagcctcatctatcttgttaccacctaagaatatctctggtcatttaaagggcctgta
aatttgagttattttcatatctaaaaattataaacttctttcttttttttttcccctcag
AATGAAATGAATGATGTGCCTTTCTTTGATATCCAACTGCCTTACGAATTGGCAATCAAT
ATATTTCAGTATCTGGACAGGAAAGAACTAGGAAGATGTGCACAG
gtaaggtgtcaccaacagatgttccagattttcctaaatgtgtgattaaggtataggact
ctccggggtaatagaaatttactcacagaattataaactttgcagaattaatgaattgga
tggcaagtttacttgaaggaaagccaccttgaccttagaggattatgttccacatcacta

 1.03 Intr +  35609  35773  165  1  0  102   86   178 0.958  19.16
gaaagataaaactggaaacatttgcttgtatttttttttccacctcatagtgttttgtta
atgagacattttatactgccataaacccagggcaataatataggtgttgattgatttttg
gatgacaaggggcttctctaattgcagaatttgacatttgtgtcacttctgctgttttag
GTGAGCAAGACGTGGAAGGTGATTGCAGAGGATGAGGTGCTGTGGTACAGGCTGTGCCAG
CAGGAAGGGCACCTTCCGGATAGCAGCATCTCTGACTATTCTTGCTGGAAGCTCATCTTC
CAAGAGTGCCGAGCCAAGGAACACATGTTACGAACCAACTGGAAG
gtgggcagtggccaatatcattacctgtgaaagaatagcctgcaaggacatgggaatcca
agctttcactcatagcctgagattaattgccaacagcgaagggagaggggtacactgagc
ctccccttcagctgttggtgacttgttgcccattttgttcaccattagatgatctgcctc

 1.04 Intr +  39863  39951   89  1  2  105   86    85 0.841   8.77
gcttaacagcttagcatgttagtcatcatctttgtctttttgaatgcccatggaactttg
aatgcacttgttgtccatgctgtagagaattgctgtggaaagtaggtgaaaaagcacgat
gcttggctttcgggctgtcccgagagcagtctaaactgcatcccccttttcctcacgcag
AATCGCAAAGGTGCCGTGAGCGAGCTGGAGCATGTTCCTGACACAGTTTTGTGTGATGTG
CATTCTCACGATGGTGTGGTCATTGCGGG
gtaagccaaaccgtttccactgagtgctctgcatctgaaggtctttcatttttctcatac
caccctctgagtaccagtgaccttagcttcctttgagagcatgtacctccctcagttaca
gcccatgtggaagagggagagtctccgtgattctgttcccaaggacgtgagagcgcgcag

 1.05 Intr +  54942  55099  158  0  2   71  115   203 0.748  20.95
ccttctgtcatctagttgacattttctcctgttggagtcactcatctaaacagtgcctca
gcagtggctctacaccacccgattcttacttgtctgttgttgtaaggctctgtgcatttt
ccccaccatagccctgctcttcaatctccttttggaaccaagtgtgtcgttctcttccag
ATATACATCAGGGGATGTGAGAGTGTGGGACACCCGCACCTGGGACTACGTAGCCCCCTT
CCTGGAATCAGAGGACGAGGAGGATGAGCCTGGAATGCAGCCAAATGTCTCCTTTGTGAG
GATAAACAGCTCGTTGGCAGTAGCAGCTTATGAGGATG
gtaagtaaccacaaccctcctccctattaaggaaaaaaaaaagctttacaaaaattaagc
agctgtggccggctcccccctgtaatccctccatatgtacacgtgggcacacacacatgt
tcacacacatacactcactcttgcttttatttgaagaagttggccaacaaccgtcaatgc

 1.06 Intr +  75451  75647  197  2  2   80   93   206 0.996  19.43
ttaccttcaggccatgtgcatcaggtatatatgaaacgtaagtgatttcgtgtttagact
tgggtctcatttccaaggtatctccgttaaaaaattttcctttgtgttgcatgtttttaa
aataattgaacatattaagtaaatttaaaattgttacctgcattgtttcttgctgcatag
GGTTTCTTAATATTTGGGATTTAAGGACCGGAAAGTACCCTGTTCATCGTTTTGAGCACG
ATGCAAGAATACAGGCACTAGCCCTCAGCCAGGACGATGCAACCGTGGCCACAGCTTCTG
CTTTTGATGTCGTGATGTTATCCCCCAATGAGGAGGGGTACTGGCAGATAGCTGCGGAAT
TTGAAGTTCCGAAACTG
gtgagctttttagtctggtcatcttattttctattcttagaatctctgggtctaatgtaa
gcacgtactaatggtgttggtaactcccattcactcagagcttcctgcgggccttacctc
cataagtctaactacagccttacaaaataggtagtagcattttccccatttaccaagaag

 1.07 Intr +  78908  79114  207  1  0   85   81   119 0.750  10.17
atactgagcatcttttctgttgtgtaagagctgtttgtgtttcatttcctgtgagtgttt
catttgcccatctttttctgttgggttgctggtcttctcattgatgtgtaggtggaattg
catatttttgatcaagtcaggatgaatttatgggactaaacaactcttaccttttaacag
GTTCAGTACCTTGAAATAGTTCCAGAAACCAGAAGGTACCCTGTGGCAGTAGCCGCTGCT
GGAGATCTGATGTACCTGCTCAAAGCCGAAGACTCCGCCAGAACCCTCCTTTACGCCCAC
GGCCCGCCTGTCACATGTCTAGACGTCTCGGCCAACCAAGTTGCTTTTGGTGTACAGGGT
CTGGGATGGGTGTACGAAGGAAGCAAG
gtacacaactagcaagatatataattaacaaaaaagaatatagatttattttttagaagg
gaattgaaaaattaaagctcttcaatatttttccagatatatcaggccagtatataagca
tggtcaaaaaattcaagaacttcaaaaggattgcaaatgaaaagtaatcattttctttct

 1.08 Intr + 100396 100524  129  0  0   43   70   106 0.704   5.19
cattccaaatcagaagcagtcagtggccccgtggtttccagacggctttctctttgttaa
gaaattagaatacctgatttccctgcgttttccttgtggcctgagtgtgcaccttggctt
gaggaattcgctggatttccttctctcttcctttgcatttctttttggcactcttaatag
CCATGTCCCTATACTATCAGTAACCTGAAAAAGATCAGGAAATTAAGTGGCAGAACATCT
TCACGGGAGCTCAGTGATAAGGATCATGCCCTCCACGATGGTGAAATGAAAGTATTTGAT
GTCGGCCTG
gtgtgtggaattgtgggcccacacatttctcttcctctctcagatcctggtgtatagcct
ggaagcaggacgccgcctcttgaagctgggtaacgttctccgtgacttcacgtgtgtcaa
cctcagcgacagccctcccaacctcatggtcagtggcaacatggacgggaggtacgtgag

 1.09 Intr + 100568 100695  128  1  2  100   94   125 0.784  13.78
cttaatagccatgtccctatactatcagtaacctgaaaaagatcaggaaattaagtggca
gaacatcttcacgggagctcagtgataaggatcatgccctccacgatggtgaaatgaaag
tatttgatgtcggcctggtgtgtggaattgtgggcccacacatttctcttcctctctcag
ATCCTGGTGTATAGCCTGGAAGCAGGACGCCGCCTCTTGAAGCTGGGTAACGTTCTCCGT
GACTTCACGTGTGTCAACCTCAGCGACAGCCCTCCCAACCTCATGGTCAGTGGCAACATG
GACGGGAG
gtacgtgagttggaagggcattgccttgcagccccatggcttctgccaaggcccggcccc
cactgcgctgctcacactgcccggttctcactcaacagctctgcccacctgagttcagcc
ccgatcccataaacactctagactcagagaacaaagtcctgtattaggtaatagttggat

 1.10 Intr + 114392 114565  174  2  0   78   90   269 0.753  25.15
accgtgtgggtcctccctgacagtctgtgcttgatgtccttattatcgatgtttgtttgc
agctgaggagtttttcatagcagtgttgtgcatagaccagcaccgtggagggggagtttg
tcatttgaagctttgactctaaccccatttcccttctctgctcttcctgggcctgtccag
GGTGAGGATCCACGACCTCCGCAGTGGTAACATCGCCCTGTCGCTCTCCGCCCATCAGCT
CAGGGTCTCTGCTGTGCAGATGGATGACTGGAAGATCGTCAGTGGAGGCGAGGAAGGCCT
GGTGTCCGTGTGGGATTATCGGATGAACCAGAAGCTGTGGGAGGTGTATTCCGG
gtaaggtgcattctagacactcttgggagttcctagtaggaacagggaaggcagcactaa
tcagcctgcaccaggcacggtgctaaatgccccctaccccccggcttcgccaggtgaatc
cttactgtgaccctaggagccagctgctgtcccagcaccgctctgcagaggaggaaacag

 1.11 Intr + 117639 117749  111  0  0   88   88   182 0.985  17.69
acctgagcttcgggaactgaggtgagacactgcttccatgggggccctgttccctctgtg
aaagagaagcttagctttatgggttctagaatcccctgcagctctgaactcccaggcctg
cggcagcaagtgcaggcccagtggacgcccccttacgagctctctcccactgccttccag
GCACCCGGTGCAGCACATCTCATTCAGCAGCCACAGCCTCATCACGGCCAACGTGCCTTA
CCAGACGGTAATGCGAAACGCCGACCTGGACAGCTTCACTACTCACAGGAG
gttagtggtggggccgggcgagtaagagaccatcttagtttgactgatgtatagaacccc
accccccccgccgtgacacattgcaccctatgggctataccctcaggcagggccctgcct
ttctgcgaattggaaacataaacgtggatgctgacctgtactgagcacccagcatctgat

 1.12 Term + 118273 118417  145  1  1  133   50   168 0.999  14.88
ccccacgttgaccgctaagccggggactgtgagtatctgacgctgtgtgcccagagaacg
cgtttgtgaagctgaacctctatctggtctcaggcgaacgcctcctgcacagacagaagc
ggctggggtgagggccagcgaggcagccctgacctgtcaccatctttgtgctctttctag
ACACCGGGGGCTGATCCGCGCCTATGAGTTTGCGGTGGACCAGCTGGCCTTCCAGAGCCC
TCTCCCTGTCTGCCGTTCATCCTGTGACGCCATGGCCACTCACTACTACGACCTCGCACT
GGCCTTTCCCTATAACCATGTTTAG
ggatgtgcctcagttgggagcaaggagaaaaatgggaagaaccagttttatccatcttaa
aacgccaggcacctcttcacaggtggtaaacatttaggggaagaaagcagcccagggtgc
catgcctgacagcacgcatctccctgacccctgcacttcccccagcgcctggggcaagct

Predicted peptide sequence(s):


>FBXW8_1|GENSCAN_predicted_peptide_1|641_aa
MDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPEVGSGRGEQASGDPALAQRLL
EGAGRPPAARATRAEGQDVASRSRSPLAREGAGGGEQLVDQLIRDLNEMNDVPFFDIQLP
YELAINIFQYLDRKELGRCAQVSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLI
FQECRAKEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTW
DYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDA
RIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVA
VAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKPCPYTIS
NLKKIRKLSGRTSSRELSDKDHALHDGEMKVFDVGLILVYSLEAGRRLLKLGNVLRDFTC
VNLSDSPPNLMVSGNMDGRVRIHDLRSGNIALSLSAHQLRVSAVQMDDWKIVSGGEEGLV
SVWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIR
AYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV