GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:19:49

Sequence DYRK2_1 : 13789 bp : 46.64% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1094   1205  112  1  1   54   21   171 0.930   7.37
agggcggcgggggcggggccgcgcgccggcgcctgtgtgtgagtgcgcgggggcgcgcgc
gcgcgggcccgggagaggctcccgagccaggcggtcttcggtcctcgcagcgcttccagc
tccccgcgcccctatgtgagggagacggggaggcccgcggcgcgcaggggagggcgaggc
ATGTGCACGGGCCGGAGGGTGCTGCAGCCGCCCGAGGAAGAGGAGGACGGCGGCGAGGAG
GAGAGCGGGGGGCTCGCGGCGGCGGGCCCCGGCCGAGGGGATGCAGTGGACT
gtgtgtgtctggctgtagcagacgcgaggcggcgacgaggcgccggggacccgcgcgagg
ggcggccgggaggcggcggcggcggccgccagaagtagcagcaggaccggcggcggcgac
ggcagccctgaaatgcattttcctctccagcggccatgttaaccaggaaaccttcggccg

 1.02 Intr +   1356   1754  399  1  0   91   16   249 0.617  12.48
cgggccccggccgaggggatgcagtggactgtgtgtgtctggctgtagcagacgcgaggc
ggcgacgaggcgccggggacccgcgcgaggggcggccgggaggcggcggcggcggccgcc
agaagtagcagcaggaccggcggcggcgacggcagccctgaaatgcattttcctctccag
CGGCCATGTTAACCAGGAAACCTTCGGCCGCCGCTCCCGCCGCCTACCCGACCGGTAAGG
AGGCCGTGCCGCCGCGCCGCATCCCCGGACCCCCGCCGGCCCTGGGCAGCCCCTGTGGCG
CGGGCGGCCGCTGCCTGCGGGACCTCGAACAAAGTCGGCGGCGCGGCGCGGGGGAGCCCC
CGGGCGGACGACGCGCCCCGGGCTCCATGCAGGGTTGTGCGCGGCCCCGAAGGCCCCTCC
GCGGGGAGCCCTCGGCCCGAAGAGGCTTCTGCCTGCCGGGGGCCCGGGCGGGGACCGTCC
AGGCCTGCCGCCCCGCCCTGCGCTGCCCGGGGCTTGGCGTGGCCGTGGCTCCCTGCTCAG
CTGTCCAAACCCACCTCCCGGCTGCTGGCCGTCTGCAAC
gtgggccgcctagccccggcgcggcccggctcccccgccgggtcgcgaactcgcgcgcca
gggccccacttaactttgcagctgcccgcgccccgcccgtgggtgtgcgctggggagccg
tgacccgaacgcccgtttttactgccccggtctcttcctccgtctttctttggaagaggg

 1.03 Intr +   2024   2172  149  0  2   80   93    94 0.793   9.05
gccccgcccgtgggtgtgcgctggggagccgtgacccgaacgcccgtttttactgccccg
gtctcttcctccgtctttctttggaagagggttgtcgctgcccagcggggttggaggggg
ggtctgggtgactttctcccccctgaccctcttttgtctcctcccgcacgtggcttccag
GCCGAGGTGGGGACAGCGCCGTTCGTCAGCTTCAGGCTTCCCCGGGGCTCGGTGCAGGGG
CCACCCGGAGCGGAGTGGGGACTGGCCCGCCCTCCCCCATCGCCCTGCCGCCTCTCCGGG
CCAGCAACGCTGCCGCCGCAGCCCACACG
gtgagacccagcccgcgggcggcccgggcggtgggggcgggaggggccccaggccgaagc
acccggacttggaggggtctgacgccgggagaagaggggtcgagatacaagcagccccac
gcctcgggccgatggtctctcgtcgacgccgccctggttaagttgggcgagcccaaagct

 1.04 Term +   9333  10940 1608  2  0   54   49  1424 0.437 125.17
tgttaggcatggcatttatgaggtccatttttcaggatcacatgttttgtggcttttact
caaaccaaatgggattttgtaaatgtgaggttgggggcggtggtgttgttgggggttact
tatacaccatttgaacagacaccacttcttttctatttatatttcctgtctgaattccag
ATTGGCGGCAGTAAGCACACAATGAATGATCACCTGCATGTCGGCAGCCACGCTCACGGA
CAGATCCAGGTTCAACAGTTGTTTGAGGATAACAGTAACAAGCGGACAGTGCTCACGACA
CAACCAAATGGGCTTACAACAGTGGGCAAAACGGGCTTGCCAGTGGTGCCAGAGCGGCAG
CTGGACAGCATTCATAGACGGCAGGGGAGCTCCACCTCTCTAAAGTCCATGGAAGGCATG
GGGAAGGTGAAAGCCACCCCCATGACACCTGAACAAGCAATGAAGCAATACATGCAAAAA
CTCACAGCCTTCGAACACCATGAGATTTTCAGCTACCCTGAAATATATTTCTTGGGTCTA
AATGCTAAGAAGCGCCAGGGCATGACAGGTGGGCCCAACAATGGTGGCTATGATGATGAC
CAGGGATCATATGTGCAGGTGCCCCACGATCACGTGGCTTACAGGTATGAGGTCCTCAAG
GTCATTGGGAAGGGGAGCTTTGGGCAGGTGGTCAAGGCCTACGATCACAAAGTCCACCAG
CACGTGGCCCTAAAGATGGTGCGGAATGAGAAGCGCTTCCACCGGCAAGCAGCGGAGGAG
ATCCGAATCCTGGAACACCTGCGGAAGCAGGACAAGGATAACACAATGAATGTCATCCAT
ATGCTGGAGAATTTCACCTTCCGCAACCACATCTGCATGACGTTTGAGCTGCTGAGCATG
AACCTCTATGAGCTCATCAAGAAGAATAAATTCCAGGGCTTCAGTCTGCCTTTGGTTCGC
AAGTTTGCCCACTCGATTCTGCAGTGCTTGGATGCTTTGCACAAAAACAGAATAATTCAC
TGTGACCTTAAGCCCGAGAACATTTTGTTAAAGCAGCAGGGTAGAAGCGGTATTAAAGTA
ATTGATTTTGGCTCCAGTTGTTACGAGCATCAGCGTGTCTACACGTACATCCAGTCGCGT
TTTTACCGGGCTCCAGAAGTGATCCTTGGGGCCAGGTATGGCATGCCCATTGATATGTGG
AGCCTGGGCTGCATTTTAGCAGAGCTCCTGACGGGTTACCCCCTCTTGCCTGGGGAAGAT
GAAGGGGACCAGCTGGCCTGTATGATTGAACTGTTGGGCATGCCCTCACAGAAACTGCTG
GATGCATCCAAACGAGCCAAAAATTTTGTGAGCTCCAAGGGTTATCCCCGTTACTGCACT
GTCACGACTCTCTCAGATGGCTCTGTGGTCCTAAACGGAGGCCGTTCCCGGAGGGGGAAA
CTGAGGGGCCCACCGGAGAGCAGAGAGTGGGGGAACGCGCTGAAGGGGTGTGATGATCCC
CTTTTCCTTGACTTCTTAAAACAGTGTTTAGAGTGGGATCCTGCAGTGCGCATGACCCCA
GGCCAGGCTTTGCGGCACCCCTGGCTGAGGAGGCGGTTGCCAAAGCCTCCCACCGGGGAG
AAAACGTCAGTGAAAAGGATAACTGAGAGCACCGGTGCTATCACATCTATATCCAAGTTA
CCTCCACCTTCTAGCTCAGCTTCCAAACTGAGGACTAATTTGGCGCAGATGACAGATGCC
AATGGGAATATTCAGCAGAGGACAGTGTTGCCAAAACTTGTTAGCTGA
gctcacgtcccctgatgctggtaacctgaaagatacgacattgctgagccttactgggtt
gaaaaggagtagctcagacctgtttttatttgctcaataactctactcatttgtatcttt
tcagcacttaattttaatgtaagaaagttgttcattttgtttttataaaatacatgagga

Predicted peptide sequence(s):


>DYRK2_1|GENSCAN_predicted_peptide_1|755_aa
MCTGRRVLQPPEEEEDGGEEESGGLAAAGPGRGDAVDSAMLTRKPSAAAPAAYPTGKEAV
PPRRIPGPPPALGSPCGAGGRCLRDLEQSRRRGAGEPPGGRRAPGSMQGCARPRRPLRGE
PSARRGFCLPGARAGTVQACRPALRCPGLGVAVAPCSAVQTHLPAAGRLQRRGGDSAVRQ
LQASPGLGAGATRSGVGTGPPSPIALPPLRASNAAAAAHTIGGSKHTMNDHLHVGSHAHG
QIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGM
GKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDD
QGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEE
IRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVR
KFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSR
FYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLL
DASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDP
LFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKL
PPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS