GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:11:15

Sequence DDIT3_1 : 6317 bp : 50.06% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   2289   2418  130  2  1   69   55    84 0.751   3.47
gagggttccccagggaggacagccctgcagagaaatacttcgggcaatattgcatctcta
gcccctagggatcagcagctgccactctgcttctgccccttccctataagagagactggg
gggagtttatccattcattcttaacaaatacttaatgaggacctactgtgtgccacacag
TTTGGGGCTCAGGGTACATCCTTGAGCAAGAGGAAAAAATCATCTCAGTGGGAGGCCTAC
AGTAAACAAAATATAAGTGCCACGGAGAAAGCTAAAGCAGAGAAAGGAATGGAGAATGTT
CAGGATGGAG
gtcagagtgttacatcaggtggtcaggaattaccttaggtaattcctccactcaaaaccc
ttcagtgacttccatgacatgaaataggaagtcattggagggtttgagcagaggaatgac
ctgttttaaaaggctcactcaggctgctgtatggtgaatagagttgcggaggggtggcaa

 1.02 Intr +   3959   4006   48  0  0  116   97    18 0.935   4.15
aatcacttgaaccgaggaggcagaggttgcagtgagccgagatcgcaccactgcacttca
gcctggcaacagagcaagacttggtctcaaaaaaaaaaaaagaaagaaaaaaagaaaaag
aaaagtaagttgcctctcccccttccaaaaatggctgacatttctctttgttgcccacag
TGTTCAAGAAGGAAGTGTATCTTCATACATCACCACACCTGAAAGCAG
gtaaacttaacctacccttttccaaaaattttaaacggcaggacagtaaatattttagat
gttaaaagtcctatagtctctagcgtgactcttcatctctgccactgtagcaccaaagca
gccataaacaatatgtaaataaacagatgtggctgtattccagtacaactttacctacaa

 1.03 Intr +   4274   4443  170  0  2   77   94   119 0.956  11.07
actcttcatctctgccactgtagcaccaaagcagccataaacaatatgtaaataaacaga
tgtggctgtattccagtacaactttacctacaaaaacaggcatcagaccagcttgccaac
ttgtggcatagactgtttgctacatggagcttgttccagccactccccattatcctgcag
ATGTGCTTTTCCAGACTGATCCAACTGCAGAGATGGCAGCTGAGTCATTGCCTTTCTCCT
TCGGGACACTGTCCAGCTGGGAGCTGGAAGCCTGGTATGAGGACCTGCAAGAGGTCCTGT
CTTCAGATGAAAATGGGGGTACCTATGTTTCACCTCCTGGAAATGAAGAG
gtaagaatgttagccctaaagctaaagggggatgttacctttcccttctcaactaatatc
tatgttccctttcctcatttccttgaaggaagaatcaaaaatcttcaccactcttgaccc
tgcttctctggcttggctgactgaggaggagccagaaccagcagaggtcacaagcacctc

 1.04 Term +   4532   4903  372  1  0   47   47   274 0.998  13.89
gggagctggaagcctggtatgaggacctgcaagaggtcctgtcttcagatgaaaatgggg
gtacctatgtttcacctcctggaaatgaagaggtaagaatgttagccctaaagctaaagg
gggatgttacctttcccttctcaactaatatctatgttccctttcctcatttccttgaag
GAAGAATCAAAAATCTTCACCACTCTTGACCCTGCTTCTCTGGCTTGGCTGACTGAGGAG
GAGCCAGAACCAGCAGAGGTCACAAGCACCTCCCAGAGCCCTCACTCTCCAGATTCCAGT
CAGAGCTCCCTGGCTCAGGAGGAAGAGGAGGAAGACCAAGGGAGAACCAGGAAACGGAAA
CAGAGTGGTCATTCCCCAGCCCGGGCTGGAAAGCAGCGCATGAAGGAGAAAGAACAGGAG
AATGAAAGGAAAGTGGCACAGCTAGCTGAAGAGAATGAACGGCTCAAGCAGGAAATCGAG
CGCCTGACCAGGGAAGTAGAGGCGACTCGCCGAGCTCTGATTGACCGAATGGTGAATCTG
CACCAAGCATGA
acaattgggagcatcagtcccccacttgggccacactacccacctttcccagaagtggct
actgactaccctctcactagtgccaatgatgtgaccctcaatcccacatacgcaggggga
aggcttggagtagacaaaaggaaaggtctcagcttgtatatagagattgtacatttattt

 2.04 PlyA -   5082   5077    6                               1.05
 2.03 Term -   5277   5131  147  0  0   99   42   175 0.999  11.90
 2.02 Intr -   5467   5375   93  1  0   84   18   104 0.873   3.16
 2.01 Intr -   5792   5721   72  2  0   88   94    47 0.953   4.90

Predicted peptide sequence(s):


>DDIT3_1|GENSCAN_predicted_peptide_1|239_aa
FGAQGTSLSKRKKSSQWEAYSKQNISATEKAKAEKGMENVQDGVFKKEVYLHTSPHLKAD
VLFQTDPTAEMAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESK
IFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGH
SPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

>DDIT3_1|GENSCAN_predicted_peptide_2|103_aa
VSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVR
ELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK