GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:00:16

Sequence DCD_1 : 6114 bp : 48.92% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1260   1317   58  2  1   74   76   136 0.941  10.47
ttgttgacttaacaggtggctctgaggtgggagaagaggaggaggagaacacaccactgg
aagactggttcccattggtccctgtcatgcttaaaaaaaggcccagagaggcagtcttga
caccctagatcccaagatctccaaggatttggtggcatacccactccagcacacagaagc
ATGAGGTTCATGACTCTCCTCTTCCTGACAGCTCTGGCAGGAGCCCTGGTCTGTGCCT
gtgagtatggctcttccccgacacccaaccatatagtcccctgaagactgggccctgcct
tcatttccccttcccctcctcgccagaggcagttcacccaagtctgtctctgtagcccac
tcctgcctcccactaggttctccacacagggactctatggtcagaggaagccaggagccc

 1.02 Intr +   2404   2442   39  2  0  123   84    27 0.467   4.00
atttggttgagataccaaaaagcatttctagtgggccccttgtgaagcagagatttctct
cctgtctgtccactgccacactcctgagattagaggcctgggaattctaggcagccctgg
ctggatacagctcatgcaactgtgccctacttgacatggtcactgttccctcctttgcag
ATGATCCAGAGGCCGCCTCTGCCCCAGGATCGGGGAACC
gtgagtcctttctcttcctcctgccccagtcctgggtgggagggttaatgacttgggata
tgagtggaggaagtcagagaagcagaaggggggtccggggaaggagagttgggaggccga
cttttaggagacatggagaagggagacttcctgagagactcatgcactggagaaggacag

 1.03 Intr +   3856   3957  102  2  0   95   94    14 0.290   2.85
gaaaaagcttgagggatgctaaagaacctaacacatcatgaaagtcaagctctagaggaa
ttgggagagagggagctatcctcaagccagaccttgagggggtaaaagcaccacctgctc
cccgaccagggtggaaagagtgaaatagctattattcctctcactcccttacccttgcag
CTTGCCATGAAGCATCAGCAGCTCAAAAGGAAAATGCAGGTGAAGACCCAGGGTTAGCCA
GACAGGCACCAAAGCCAAGGAAGCAGAGATCCAGCCTTCTGG
gtaagcctctttcccaatgcctggtatagaattctgatgcatgaaacagcaagatatctg
ggggccagtctgccctcacaggcacaagcacagggacacagctacacccatattcctagg
gagggcttggggtgcacacctgcttctacatacagggtttctgggccataggttttgcag

 1.04 Intr +   4301   4390   90  0  0   87  113    17 0.269   4.07
ggccataggttttgcagctaatactggcctaccaaccttcccatgacagagaagttggtt
ccttcagcaaaaccacttcaccttaggggtgcccatggtgcctaggaagcgggggagctc
tcctacaaaggaagtagtttttctgcttctatgacctcttcttttctgaatccaccctag
AAAAAGGCCTAGACGGAGCAAAAAAAGCTGTGGGGGGACTCGGAAAACTAGGAAAAGATG
CAGTCGAAGATCTAGAAAGCGTGGGTAAAG
gtgagtatatgtccccactcctccctcaggaccagcctcagtctccaccccttgcatgag
atctgaaactgccacagcccccccattgaagacccctcactttgtgctttcaaatgtctc
caattcctcatccagatttaaattgccattcttgtctgatattgatacttcctggggtct

Predicted peptide sequence(s):


>DCD_1|GENSCAN_predicted_peptide_1|97_aa
MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRK
QRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKX