GENSCAN 1.0	Date run: 15-Jan-104	Time: 02:35:37

Sequence CDKN1B_1 : 7393 bp : 43.51% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1666   2140  475  0  1   53   47   489 0.624  36.94
ccgcagcccctgcgcgctcctagagctcgggccgtggctcgtcggggtctgtgtcttttg
gctccgagggcagtcgctgggcttccgagaggggttcgggctgcgtaggggcgctttgtt
ttgttcggttttgtttttttgagagtgcgagagaggcggtcgtgcagacccgggagaaag
ATGTCAAACGTGCGAGTGTCTAACGGGAGCCCTAGCCTGGAGCGGATGGACGCCAGGCAG
GCGGAGCACCCCAAGCCCTCGGCCTGCAGGAACCTCTTCGGCCCGGTGGACCACGAAGAG
TTAACCCGGGACTTGGAGAAGCACTGCAGAGACATGGAAGAGGCGAGCCAGCGCAAGTGG
AATTTCGATTTTCAGAATCACAAACCCCTAGAGGGCAAGTACGAGTGGCAAGAGGTGGAG
AAGGGCAGCTTGCCCGAGTTCTACTACAGACCCCCGCGGCCCCCCAAAGGTGCCTGCAAG
GTGCCGGCGCAGGAGAGCCAGGATGTCAGCGGGAGCCGCCCGGCGGCGCCTTTAATTGGG
GCTCCGGCTAACTCTGAGGACACGCATTTGGTGGACCCAAAGACTGATCCGTCGGACAGC
CAGACGGGGTTAGCGGAGCAATGCGCAGGAATAAGGAAGCGACCTGCAACCGACG
gtaatgaccctttcccaaccatagaatgtgtttggggccccgctttgcctgctggagggt
gttaaccttagcttgcttttcggcgtattctgatttagctttgggagagctaactttatt
ggtcttaggtgttcagtgctacctggcccactgcttgtctgtttgtgacttttaagtcag

 1.02 Term +   2651   2772  122  0  2   39   41    96 0.481  -1.36
ttctgttttttgaaaacaacctcattttgtgcccttaaaagccactggggatgacggatc
caggattgtgggtggaggtagtgggtttttcatcccctgactatggggccaacttctgcc
agccattgttttttctaataaagattgtgtgttctttttaaaaatttcccctgcgcttag
ATTCTTCTACTCAAAACAAAAGAGCCAACAGAACAGAAGAAAATGTTTCAGACGGTTCCC
CAAATGCCGGTTCTGTGGAGCAGACGCCCAAGAAGCCTGGCCTCAGAAGACGTCAAACGT
AA
acagctcggtgggttgatcactaaaggagcacgcactggaacccggggccttcagacctc
acgatacctgatcttactggttgctggcaaattaaaagcttatggggttttgttttgttt
atacttcgtgaggtcaaaaaagtagcaatggggaaggctggggatacggtaattcctcag

Predicted peptide sequence(s):


>CDKN1B_1|GENSCAN_predicted_peptide_1|198_aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT