GENSCAN 1.0	Date run: 15-Jan-104	Time: 03:03:47

Sequence CDK2AP1_1 : 13545 bp : 56.37% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1851   1956  106  2  1   68   66   162 0.015  10.34
ccgccctcgcggcctggccccgccgcgcccggcgcgcccgccgcccggggggatgtctta
caaaccgaacttggccgcgcacatgcccgccgccgccctcaacgccggtgagtgagccgc
gtgcgacgcgccccaagcgccgccaagttgggggtccgcgcgcccggccccggcccgggg
ATGCCCGGGGCGCCCGCGGAGGCCGGGGGCGGGGGGCTCAGGGTCCCGGCCCGGGGCAGC
GCTGCCGCCGCCATGATTCCCGAGCCCGCGCCGCGAAAGTTCTCTG
gtgcgccccgcacgccgagggcctcggctgggggtgcggggcgggcggcccggggtgacc
cccgcgccggcggctgcggatcgcagggagcgcggcgggcgagggcgagggcgggggagg
cttgttctcggctcctttttcctccggcttctgggcggctcggcgagggcccctgccggc

 1.02 Intr +   6059   6156   98  0  2  112   91   174 0.838  20.33
tgtagctacatttcattatccatcttatatgctggtcaaaccggaggtggagagcagggt
tctccatcctgctacagttggtggtgtgggtcctgggcaagggctgttgcaggacccgga
gtccttgccttggtacaactggctgagctgactcctggcctctctctccccaccccacag
CTGGGAGTGTCCACTCGCCTTCCACCAGCATGGCAACGTCTTCACAGTACCGCCAGCTGC
TCAGTGACTACGGGCCACCGTCCCTAGGCTACACCCAG
gtatgtcaatgggggtgatggcatggtgggagggccagggggagacatgcttcccaccat
cagaggagagaagttggtggaagagacgaaggagcagaaaggatgggacggagctttctc
agcccaaggccctggctgcgctcctgctcagaacacatcagagtggagggcactggggac

 1.03 Intr +   8019   8145  127  2  1  103  103   170 0.955  20.76
gagatggagtctcgctctgttgcccaggctggagtgcagtggagtgatcttggctcactg
caacttccacctcctgggtccaagcagttctcctgcctcagcctcctgagtaactgggac
tacaggcacgcaccaccacgcccggctgattttgctgaacccatttctttctgattctag
GGAACTGGGAACAGCCAGGTGCCCCAAAGCAAATACGCGGAGCTGCTGGCCATCATTGAA
GAGCTGGGGAAGGAGATCAGACCCACGTACGCAGGGAGCAAGAGTGCCATGGAGAGGCTG
AAGCGCG
gtaagcccggccccgctgccctgtcggtgaccacagtgctagacctttaactctggaaag
acttttggggaaaatgtgggaaggtgggctagggatgaggctcactcatgggagctcctg
tcttgttacagagttgccgtctgtggtggaggcctcaggcaggcgatgggtctggtagcg

 1.04 Term +  12838  12980  143  2  2   82   38    95 0.433   2.30
accttagcctctcaaagtactgggattataggtgtgagctaccacgcctggtgtaaagaa
gtgctattttaaataatctctcatgaaagtgtttgaaatgcttgttccccggtgccgtga
agaaatagcacttgaacataaatttaatttactcagcaaggccatttttacttcccgcag
AAAGGGTACATTCGCCAGCAGTTTTGCCACGAGAGTACACCGAACAAAGAGACAGGGTCA
TTTGTAACCTGATGCGTCCACCCTACTGCTGTGTCCGGTTTCCATTGGCTGGAACGGGAC
CTCATATTCTGTATTTGTCCTGA
ttgggaagcaacttaaaactttttaaaagaggcgaaggcagaagagaacaaaggaaggag
aaagtaacttgtggaatggtgagaaaggtaaacacttttaaataaggaagaggaacaggc
tatgacctaatgcttgctccgaccagtgtaagcatgccaggacaaatatttaggctaaat

Predicted peptide sequence(s):


>CDK2AP1_1|GENSCAN_predicted_peptide_1|157_aa
MPGAPAEAGGGGLRVPARGSAAAAMIPEPAPRKFSAGSVHSPSTSMATSSQYRQLLSDYG
PPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRERVHSPAVLP
REYTEQRDRVICNLMRPPYCCVRFPLAGTGPHILYLS