GENSCAN 1.0	Date run: 14-Jan-104	Time: 23:34:34

Sequence TSSC4_1 : 3982 bp : 61.55% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Sngl +   1542   2531  990  2  0   65   54   733 0.984  64.70
agaggagggcttggagggggaggcgggactccaccctgtgtgggacagttctgtcagttg
accctccacttgtccaggggcagtggatctgcagggggaactcattctcaatactgttcc
tcctgagaaacaaattttctgggctgttttggtttaggtgtggcgtggccctggggacgc
ATGGCTGAGGCAGGAACAGGTGAGCCGTCCCCCAGCGTGGAGGGCGAACACGGGACGGAG
TATGACACGCTGCCTTCCGACACAGTCTCCCTCAGTGACTCGGACTCTGACCTCAGCTTG
CCCGGTGGTGCTGAAGTGGAAGCACTGTCCCCGATGGGGCTGCCTGGGGAGGAGGATTCA
GGTCCTGATGAGCCGCCCTCACCCCCGTCAGGCCTCCTCCCAGCCACGGTGCAGCCATTC
CATCTGAGAGGCATGAGCTCCACCTTCTCCCAGCGCAGCCGTGACATCTTTGACTGCCTG
GAGGGGGCGGCCAGACGGGCTCCATCCTCTGTGGCCCACACCAGCATGAGTGACAACGGA
GGCTTCAAGCGGCCCCTAGCGCCCTCAGGCCGGTCTCCAGTGGAAGGCCTGGGCAGGGCC
CATCGGAGCCCTGCCTCACCAAGGGTGCCTCCGGTCCCCGACTACGTGGCACACCCCGAG
CGCTGGACCAAGTACAGCCTGGAAGATGTGACCGAGGTCAGCGAGCAGAGCAATCAGGCC
ACCGCCCTGGCCTTCCTGGGCTCCCAGAGCCTGGCTGCCCCCACTGACTGCGTGTCCTCC
TTCAACCAGGATCCCTCCAGCTGTGGGGAGGGGAGGGTCATCTTCACCAAACCAGTCCGA
GGGGTCGAAGCCAGACACGAGAGGAAGAGGGTCCTGGGGAAGGTGGGAGAGCCAGGCAGG
GGCGGCCTTGGGAATCCTGCCACAGACAGGGGCGAGGGCCCTGTGGAGCTGGCCCATCTG
GCCGGGCCCGGGAGCCCAGAGGCTGAGGAGTGGGGCAGCCACCATGGAGGCCTGCAGGAG
GTGGAGGCACTGTCAGGGTCTGTCCACAGTGGGTCTGTGCCAGGTCTCCCGCCGGTGGAA
ACTGTTGGCTTCCATGGCAGCAGGAAGCGGAGTCGAGACCACTTCCGGAACAAGAGCAGC
AGCCCCGAGGACCCAGGTGCTGAGGTCTGA
gagggagatggcccagcctgaccccactggccactgccatcctgctgccttcccagtggg
gctggtcagggggcagcctggccactgcctagctggaatgggaggaagcctgcaggtggc
accggtggccctggctgcagttctgggcagcatcctcccaagcagagaccttgctgaagc

Predicted peptide sequence(s):


>TSSC4_1|GENSCAN_predicted_peptide_1|329_aa
MAEAGTGEPSPSVEGEHGTEYDTLPSDTVSLSDSDSDLSLPGGAEVEALSPMGLPGEEDS
GPDEPPSPPSGLLPATVQPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNG
GFKRPLAPSGRSPVEGLGRAHRSPASPRVPPVPDYVAHPERWTKYSLEDVTEVSEQSNQA
TALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGR
GGLGNPATDRGEGPVELAHLAGPGSPEAEEWGSHHGGLQEVEALSGSVHSGSVPGLPPVE
TVGFHGSRKRSRDHFRNKSSSPEDPGAEV