GENSCAN 1.0	Date run: 15-Jan-104	Time: 00:56:20

Sequence THY1_1 : 7366 bp : 56.34% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   3440   3570  131  1  2   86   61   130 0.945   7.69
gcagtatcatgttcagtgagatgcagggacgagagggggaatggagagagggacttagat
gactgccatagccactatgccatgttcccagggacccccagccctggtggtaagtgtggc
acagcttggctgattcccatcctgttcccaccccagatccaggactgagatcccagaacc
ATGAACCTGGCCATCAGCATCGCTCTCCTGCTAACAGGTACCCGGCATGGGGCAGGACTG
GGGCTCCAGGCGCCCTGGCTTCCTTCCCTCCAGAGAAGCAGCTTCTCCCTCACAGTCTCA
GAAAAGCGCAG
gtgacaaagagagggctctttttcatcctgaagtcagccaatccaccgcgctgatattct
gacggcctgaggtggtttttgaaaacacagtttgctgagccctccttcacactattgaac
tagaatccccaactgagaacccggaaccagcatcaactccctaagatctcctgtccttga

 1.02 Intr +   3897   4294  398  0  2  104   78   453 0.952  40.69
ccagcatcaactccctaagatctcctgtccttgaaacacattgataggatccaaggctca
agcagagtggggagggaggctggggtctgcaaaggagaagtgggatccctggggtgggga
aaggcactcagagagcagaccccggtcccctccctagccaggcccatctctccacttcag
GTGGGTGGGAGGCCCCTGTGCCGCAGGCCCCTCCAGTTTGAAGGAGGCACTGCTGGTGCC
AGTCTTGCAGGTCTCCCGAGGGCAGAAGGTGACCAGCCTAACGGCCTGCCTAGTGGACCA
GAGCCTTCGTCTGGACTGCCGCCATGAGAATACCAGCAGTTCACCCATCCAGTACGAGTT
CAGCCTGACCCGTGAGACAAAGAAGCACGTGCTCTTTGGCACTGTGGGGGTGCCTGAGCA
CACATACCGCTCCCGAACCAACTTCACCAGCAAATACAACATGAAGGTCCTCTACTTATC
CGCCTTCACTAGCAAGGACGAGGGCACCTACACGTGTGCACTCCACCACTCTGGCCATTC
CCCACCCATCTCCTCCCAGAACGTCACAGTGCTCAGAG
gtgagacaagcccctaacaaggtcaagtgagctgggagagccaggctcggggacagcagg
cagttcccttggctggactagagaggagaatagccccataacgctctcaccctctcccaa
ctgctgcctggtcaactggggaaccattgccttcggtgtgaatggggtgaagagctcagg

 1.03 Term +   4825   4937  113  2  2  126   42   153 0.999  13.53
agtaatctgcaaatgggaaagatggctggttctgtgagaccgggctgttcctggtcccag
ctaagacattgcagtacccacctcccaaagggagtacacccttgctttgggcctgtgcct
gcctgagtcctgatccgtcttccttcctaccctgcccccggcccccttctctttctgcag
ACAAACTGGTCAAGTGTGAGGGCATCAGCCTGCTGGCTCAGAACACCTCGTGGCTGCTGC
TGCTCCTGCTCTCCCTCTCCCTCCTCCAGGCCACGGATTTCATGTCCCTGTGA
ctggtggggcccatggaggagacaggaagcctcaagttccagtgcagagatcctacttct
ctgagtcagctgaccccctccccccaatccctcaaaccttgaggagaagtggggacccca
cccctcatcaggagttccagtgctgcatgcgattatctacccacgtccacgcggccacct

Predicted peptide sequence(s):


>THY1_1|GENSCAN_predicted_peptide_1|213_aa
MNLAISIALLLTGTRHGAGLGLQAPWLPSLQRSSFSLTVSEKRRWVGGPCAAGPSSLKEA
LLVPVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVG
VPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLV
KCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL