GENSCAN 1.0	Date run: 15-Jan-104	Time: 01:33:24

Sequence RPS6KA4_1 : 15443 bp : 57.44% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1266   1320   55  2  1  108   98   161 0.841  20.63
cggcgctgtcacgttccagccgcctgactcaggccgcgcagggcggggagccgggaggcg
gtgccggcgcccgcctcggccccggaggcggcaccaggaagcgcccgccccggccggagc
cgccatgtaaccggcgccgcccggagcccgagccgcgcgggccccagcgacccgcccgcc
ATGGGGGACGAGGACGACGATGAGAGCTGCGCCGTGGAGCTGCGGATCACAGAAG
gtgggtgtggggcctgactgcggctgcccggggcaggccgggacgggtcatggaccggct
gggctcattcgccccctgtgcccacagccaacctgaccgggcacgaggagaaggtgagcg
tggagaacttcgagctgctcaaggtgctgggcacgggaggtgaggacccccatccaccgg

 1.02 Intr +   1408   1479   72  2  0   94   78   153 0.679  15.43
ggagcccgagccgcgcgggccccagcgacccgcccgccatgggggacgaggacgacgatg
agagctgcgccgtggagctgcggatcacagaaggtgggtgtggggcctgactgcggctgc
ccggggcaggccgggacgggtcatggaccggctgggctcattcgccccctgtgcccacag
CCAACCTGACCGGGCACGAGGAGAAGGTGAGCGTGGAGAACTTCGAGCTGCTCAAGGTGC
TGGGCACGGGAG
gtgaggacccccatccaccgggcaggcgtcccaggcgcggtgcccctgacctcctgcctg
ctcactcttgggcctgggccaggccactgagcaggccccccaccctttcccggcacagcc
tgccttgcctgccccgccctgcctcgccagagtttgcatgcccacttccagggcactcca

 1.03 Intr +   2193   2411  219  1  0  105   80   548 0.996  55.20
ctcccggggtgtgcacaccctttccttagaaggctctgccagctttttgcacacctgcct
gttgccccagctccttcgcctcatttgcacaccctcctgggttggcatcgcccccacccc
ccaagcctgcaccaatctcccgctcacagcccaccctccacccactcgctgctcccacag
CCTACGGCAAGGTGTTCCTGGTGCGGAAGGCGGGCGGGCACGACGCGGGGAAGCTGTACG
CCATGAAGGTGCTGCGCAAGGCGGCGCTGGTGCAGCGCGCCAAGACGCAAGAGCACACGC
GCACCGAGCGCTCGGTGCTGGAGCTGGTGCGCCAGGCGCCCTTCCTGGTCACGCTGCACT
ACGCTTTCCAGACGGATGCCAAGCTGCACCTCATCCTGG
gtgagcgcacaccacatcccaacggggttggggtggctgggggcaggcgaggccacctga
cggggctgcttcctgacttccactgcacctcccagactatgtgagcggcggggagatgtt
cacccacctctaccagcgccagtacttcaaggaggctgaggtgcgcgtgtatgggggtga

 1.04 Intr +   2507   2622  116  0  2   64   98   180 0.802  17.94
gtgctggagctggtgcgccaggcgcccttcctggtcacgctgcactacgctttccagacg
gatgccaagctgcacctcatcctgggtgagcgcacaccacatcccaacggggttggggtg
gctgggggcaggcgaggccacctgacggggctgcttcctgacttccactgcacctcccag
ACTATGTGAGCGGCGGGGAGATGTTCACCCACCTCTACCAGCGCCAGTACTTCAAGGAGG
CTGAGGTGCGCGTGTATGGGGGTGAGATCGTGCTGGCCCTGGAACACCTGCACAAG
gtgggtgaagacctggccgcaggctgttgctatggaaactgggtctgtgccttggaagga
atctgcacgcagggcagcctcaggcttccccctgggcttcctggggggccagtggtgagc
tgggtgggaattggagctgcttcccctggaccccttgcaggaagcctcaacgttgcctgg

 1.05 Intr +   3164   3271  108  1  0   78  105   229 0.975  25.25
ctccttctttgttttatatcttaaatggcctttcttattcagtggctctgccctggagac
cccctctacaggcagatgactttctctggggggtctccttatcctgagcagggccaggag
ctggaggagctggggagggtttcggggaggaagcctcagcacccctcttgctcctaccag
CTCGGCATCATTTACCGAGACCTGAAACTGGAGAATGTGCTGCTGGACTCCGAGGGCCAC
ATTGTCCTCACGGACTTCGGGCTGAGCAAGGAGTTCCTGACGGAGGAG
gtgagtggaggccacctctgcctgcagtgccccattcaatccttctccttcctgcctctt
cctgctctgggcctgcattctggggctgcagaagtgaatagctccaagaagtttccacag
ctcagctctccaacctcacaagttgagcgagtcttactctgggccttgtggggcactggg

 1.06 Intr +   3499   3579   81  0  0   73  100   129 0.992  13.59
cttcctgcctcttcctgctctgggcctgcattctggggctgcagaagtgaatagctccaa
gaagtttccacagctcagctctccaacctcacaagttgagcgagtcttactctgggcctt
gtggggcactggggcacaggagaggtttcgacatctaagcaggacctcttgccctcccag
AAAGAGCGGACCTTCTCCTTCTGTGGCACCATCGAGTACATGGCCCCCGAAATCATCCGT
AGCAAGACGGGGCATGGCAAG
gtaggttggcagggaagtggggctgggggaggtggaaaggtggggtgtgaggcaggggag
atgcaggccctcaccccggctccacccggcaggctgtggactggtggagcctgggcatct
tgctcttcgagctgctgacgggggcctcgcccttcaccctggagggcgagaggaacacgc

 1.07 Intr +   3672   3775  104  2  2   54  109   173 0.999  16.14
ctcccagaaagagcggaccttctccttctgtggcaccatcgagtacatggcccccgaaat
catccgtagcaagacggggcatggcaaggtaggttggcagggaagtggggctgggggagg
tggaaaggtggggtgtgaggcaggggagatgcaggccctcaccccggctccacccggcag
GCTGTGGACTGGTGGAGCCTGGGCATCTTGCTCTTCGAGCTGCTGACGGGGGCCTCGCCC
TTCACCCTGGAGGGCGAGAGGAACACGCAGGCTGAGGTGTCTCG
gtgagtagggctggacgtggagggcggccagagggctgcagggcctgcctgggcagggct
gtgggtggggggcttgctgcccctgacacccccccaatcctcccagacggatcctgaagt
gctcccctcccttcccccctcggatcgggcccgtggcgcaggacctgctgcagcggctgc

 1.08 Intr +   3882   4032  151  0  1  109   94   139 0.978  17.95
ctcttcgagctgctgacgggggcctcgcccttcaccctggagggcgagaggaacacgcag
gctgaggtgtctcggtgagtagggctggacgtggagggcggccagagggctgcagggcct
gcctgggcagggctgtgggtggggggcttgctgcccctgacacccccccaatcctcccag
ACGGATCCTGAAGTGCTCCCCTCCCTTCCCCCCTCGGATCGGGCCCGTGGCGCAGGACCT
GCTGCAGCGGCTGCTTTGTAAGGATCCTAAGAAGCGATTGGGCGCGGGGCCCCAGGGGGC
ACAAGAAGTCCGGAACCATCCCTTCTTCCAG
gtgaggctgactcagggccccatacctcctggtgcatacccaggtggggctgctgttcca
ggttgaggttgtgcctggccagtttcactttatttggaaatccccccagagaaagaaagc
aagtgtgtgtcagctaggtttctcttcacatccatccccactgaaacttggcagatgtgt

 1.09 Intr +   7331   7495  165  1  0  138   94   145 0.999  21.45
gaatagggattgtgttaccagagggagagagaagccagggaggcaggaggaacagctgcc
caccccaaatgccagatgggcccttgcctcatggaggaactgcccagtgagggtgggctg
agtggagggagtttctcgttcctggcctttgacacctgacctctgattcccttccctcag
GGCCTCGATTGGGTGGCTCTGGCTGCCAGGAAGATTCCAGCCCCATTCCGGCCCCAAATC
CGCTCAGAGCTGGATGTGGGCAACTTTGCGGAGGAATTCACTCGGCTGGAGCCTGTCTAC
TCACCCCCTGGCAGCCCCCCACCTGGGGACCCCCGAATCTTTCAG
gtgaggggaaactcatggaacccagatgcaggagagatgagatgttgctgtctgcctcag
ccctggctggcccgaggacactgcctaggccttgtgtcctgattgggactcagcgtctcc
cctagacgtcgccacttcagtgggacctagggttgtcagtcacagagaccacccaggcag

 1.10 Intr +  10162  10290  129  0  0   87   80   107 0.873  11.87
tataaaaccaggtggaataaaaagtgtccacacatcctgtgtgtaccagaatgcaactgg
aacaccccccactgcccccttgtccagggtcttgcctttgcctggttccccaccagagtc
tcctcacccgcacccccaacccccatgcccatgcccattccccggactcccgccctgcag
GGATACTCCTTTGTGGCACCCTCCATTCTCTTTGACCACAACAACGCGGTGATGACCGAT
GGGCTGGAAGCGCCTGGTGCTGGAGACCGGCCAGGTCGGGCAGCGGTGGCCAGGAGCGCT
ATGATGCAG
gtgggctgggctgggctgggttggggggaaattggttttaggagaggcctaggcccgggg
actctaggcctagatccaactggcgcccgcagcgtgagctcagcaaggtcctaagcctct
ccgacatggggcgtggcggggccgcggggctaccaggtgggacctctgacgcgccgcctt

 1.11 Intr +  10498  10631  134  0  2   87   75   247 0.952  23.92
gaaattggttttaggagaggcctaggcccggggactctaggcctagatccaactggcgcc
cgcagcgtgagctcagcaaggtcctaagcctctccgacatggggcgtggcggggccgcgg
ggctaccaggtgggacctctgacgcgccgccttcgccttcgccttcgccttcgcctccag
GACTCGCCCTTCTTCCAGCAGTACGAGCTGGACCTGCGGGAGCCTGCGCTGGGCCAGGGC
AGCTTTTCTGTGTGTCGCCGCTGCCGCCAGCGCCAGAGCGGCCAGGAGTTCGCAGTCAAG
ATCCTCAGTCGCAG
gtgggagggcccaggcgcgggcaggggtgggggtggcagagcgctgtcccgggggcgggg
ccgaagcgcggcgaccgtaactccttctgctccgtcccccaggctggaggcgaacacgca
gcgcgaagtggctgccctgcgcctgtgccagtcacaccccaacgtggtgaatctgcacga

 1.12 Intr +  10734  10827   94  0  1  107   64   128 0.977  13.43
gggcagcttttctgtgtgtcgccgctgccgccagcgccagagcggccaggagttcgcagt
caagatcctcagtcgcaggtgggagggcccaggcgcgggcaggggtgggggtggcagagc
gctgtcccgggggcggggccgaagcgcggcgaccgtaactccttctgctccgtcccccag
GCTGGAGGCGAACACGCAGCGCGAAGTGGCTGCCCTGCGCCTGTGCCAGTCACACCCCAA
CGTGGTGAATCTGCACGAGGTGCATCACGACCAG
gtgatggcttccggccaggggagggcggagagaaaaggggcaggcggcggggcttggggg
cactatgggcgggatctaggggtgaattgggcggggcctagcgtttgattcggggcccaa
agggaccagggaggcgcagggagtggaatttgaggggagtagggcctgaggacgggaagg

 1.13 Intr +  11476  11649  174  0  0   73   64   435 0.997  40.94
gggcgacaaagcgagactgtctccaaaaaagtaacaaagaaagaaagaaagaaaaaggac
tttgaggagggggttctcgaacattggcagggcccgaaggccgggggcggggcctgggtg
gtgggagggggcttgccgccgtgggtgggtgttgaccttggcccgccacgccgcccgcag
CTGCACACGTACCTGGTCCTGGAGCTGCTGCGGGGCGGGGAGCTGCTGGAGCACATCCGC
AAGAAGCGGCACTTCAGCGAGTCGGAAGCAAGCCAGATCCTGCGCAGCCTCGTGTCGGCC
GTGAGCTTCATGCACGAGGAGGCGGGCGTGGTGCACCGCGACCTCAAGCCGGAG
gtgggcgagctgcctcggcggcggggcggagcggtggcgccgggggctgcctctgaccac
taccccgccgccctcgcagaacatcctgtacgccgacgacacgcccggggccccggtgaa
aatcatcgacttcgggttcgcgcggttgcggccgcagagtcccggggtgcccatgcagac

 1.14 Intr +  11729  11923  195  1  0  139   60   467 0.935  49.82
tcagcgagtcggaagcaagccagatcctgcgcagcctcgtgtcggccgtgagcttcatgc
acgaggaggcgggcgtggtgcaccgcgacctcaagccggaggtgggcgagctgcctcggc
ggcggggcggagcggtggcgccgggggctgcctctgaccactaccccgccgccctcgcag
AACATCCTGTACGCCGACGACACGCCCGGGGCCCCGGTGAAAATCATCGACTTCGGGTTC
GCGCGGTTGCGGCCGCAGAGTCCCGGGGTGCCCATGCAGACGCCCTGCTTCACGCTGCAG
TACGCTGCCCCCGAGCTGCTGGCGCAGCAGGGCTACGACGAGTCCTGCGACCTCTGGAGC
CTGGGCGTCATTCTG
gtatgggacgcggtccttgaggcggggtcagggtcgctcggacctggcgtcttcctgatg
tgcagcagcacgagggaggggacaggggtcatcttggtgggggcggctgggtttcgtccg
aagctgggatcggggtggttcaaatacagaggtggggtcgctctggtgctagagtcggag

 1.15 Intr +  12255  12414  160  2  1   88   64   119 0.915  10.25
gtggggtcgctctggtgctagagtcggagcatccgggtattgggggttagaagtcagggt
tcaccacgcgtgggtctcaggagtgcccctagtggggagggtgagtggttctgtgggagc
ggaggggtcagcctcggcaccccagcctgggccggcctcaccttcccctcaccctcctag
TACATGATGCTGTCGGGGCAGGTCCCCTTCCAGGGGGCCTCTGGCCAGGGCGGGCAGAGC
CAGGCGGCCGAGATCATGTGCAAAATCCGCGAGGGGCGCTTCTCCCTTGACGGGGAGGCC
TGGCAGGGTGTATCCGAGGAAGCCAAGGAGCTGGTCCGAG
gtgcggagctggaggtcatagaccatggttggggagggggacgctgggacagggatggtc
actgggccaggtgtcctggttggggatgggtaggggaggagagtggggctgttacgatct
ctttggggctcagcctttacgccaggctcctccccacacttccttgccccgcctccaggg

 1.16 Intr +  12593  12756  164  0  2  103   91   300 0.996  32.69
aggtgcggagctggaggtcatagaccatggttggggagggggacgctgggacagggatgg
tcactgggccaggtgtcctggttggggatgggtaggggaggagagtggggctgttacgat
ctctttggggctcagcctttacgccaggctcctccccacacttccttgccccgcctccag
GGCTCCTGACCGTGGACCCCGCCAAGCGGCTGAAGCTCGAGGGACTGCGGGGCAGCTCGT
GGCTGCAGGACGGCAGCGCGCGCTCCTCGCCCCCGCTCCGGACGCCCGACGTGCTCGAGT
CCTCTGGGCCCGCAGTGCGCTCGGGTCTCAACGCCACCTTCATG
gtaaggggcagggtctgttgaagggaaggggtgggcgaagcctcgagaggtggggtctgg
ggaggcccggccatcggagcacagaaaggcgaggtgaggccgggcgcggtggctcacgcc
tgtaatcccagcgctttgggaggccgaggcgggcggatcacgaggtcaggggttcgagac

 1.17 Term +  13313  13510  198  1  0   74   36   191 0.999  10.87
aaaaaaaaaaaaaaaaaaaaaaaagggaggtgaaccgaatccggtggtcggtctggaggc
caaggccctgtcggccttgacctaggcggctggaggcaaggtctgggaatggaggtcaaa
ctagatctggaagccggggtcaggcgggggtgggggcactcaccctttcctttctgccag
GCATTCAACCGGGGCAAGCGGGAGGGCTTCTTCCTGAAGAGCGTGGAGAATGCACCCCTG
GCCAAGCGGCGGAAGCAGAAGCTGCGGAGCGCCACCGCCTCCCGCCGGGGCTCCCCTGCA
CCAGCCAACCCGGGCCGAGCCCCCGTCGCCTCCAAAGGGGCCCCCCGCCGAGCCAACGGC
CCCCTGCCCCCCTCCTAA
tccccaccactgtgacccccttccctcataggggctgtgacctgggagcccggctcactc
ccggaggcctctgcctgcggctgacctgatccccaagggactgtcctttcctctcctacc
ccaccccactcccagacagagcagaagtatttttataagcagagaattttttatgtctta

Predicted peptide sequence(s):


>RPS6KA4_1|GENSCAN_predicted_peptide_1|772_aa
MGDEDDDESCAVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKTGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVNLHEVHHDQLHTY
LVLELLRGGELLEHIRKKRHFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPGVPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRGSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS