GENSCAN 1.0	Date run: 15-Jan-104	Time: 01:44:06

Sequence RBM14_1 : 13101 bp : 50.70% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1280   1616  337  1  1   80   92   652 0.876  62.24
cgtttctgattggtcgctggacgcgcgggatgcgagtccccattggctaggccagggcgc
ctgcgcggcggggttctcggtcgccagccattcctgaggaggactgccggtcgttcggac
gtcttgcctgtcgctggaggagaggtccgggctctccaggaaggtggctgcggcgacaaa
ATGAAGATATTCGTGGGCAACGTCGACGGGGCGGATACGACTCCGGAGGAGCTGGCAGCC
CTCTTTGCGCCCTACGGCACGGTCATGAGCTGCGCCGTCATGAAACAGTTCGCCTTCGTG
CACATGCGCGAGAACGCGGGCGCGCTGCGCGCCATCGAAGCCCTGCACGGCCACGAGCTG
CGGCCGGGGCGCGCGCTCGTGGTGGAGATGTCGCGCCCAAGGCCTCTTAATACTTGGAAG
ATTTTCGTGGGCAATGTGTCGGCTGCATGCACGAGCCAGGAACTGCGCAGCCTCTTCGAG
CGCCGCGGACGCGTCATCGAGTGTGACGTGGTGAAAG
gtaacgcggaggcgcgctcgggggcgggggcgcgctcggggcactctgcctgttagccac
gccccttacccgggggtcggtcactgcgcggttgggaggggtggggaagtgcgcgggagc
aggtcggaggtgttgggggcgcgttgggtagagccaccctcctcccctgcggtccaggaa

 1.02 Intr +   8773  10237 1465  2  1  107   79  1412 0.998 130.98
gacagtcagaagctttgttatatgggagctacattttatgacatactcctggagaggagg
gtttggaggccttggaggtagctggcaacagctgggtgctgttgtgtgtccaatttggga
cccatcaggtagcatgccctgcccccctaattgctaaccctctgtctgctgctttatcag
ACTACGCGTTTGTTCACATGGAGAAGGAAGCAGATGCCAAAGCCGCAATCGCGCAGCTCA
ACGGCAAAGAAGTGAAGGGCAAGCGCATCAACGTGGAACTCTCCACCAAGGGTCAGAAGA
AGGGGCCTGGCCTGGCTGTCCAGTCTGGGGACAAGACCAAGAAACCAGGGGCTGGGGATA
CGGCCTTCCCTGGAACTGGTGGCTTCTCTGCCACCTTCGACTACCAGCAGGCTTTTGGCA
ACAGCACTGGTGGCTTTGATGGGCAAGCCCGTCAGCCCACACCACCCTTCTTTGGTCGCG
ACCGCAGCCCTCTGCGCCGTTCACCTCCCCGAGCCTCTTATGTGGCTCCTCTGACGGCCC
AGCCAGCTACCTACCGGGCCCAGCCGTCCGTGTCACTGGGAGCTGCCTACAGGGCCCAGC
CTTCTGCCTCTTTGGGTGTTGGCTATCGGACTCAGCCCATGACAGCCCAGGCAGCCTCTT
ACCGCGCTCAGCCCTCTGTCTCCCTTGGGGCACCATACAGGGGCCAGCTGGCTAGTCCTA
GCTCCCAGTCTGCTGCAGCTTCTTCACTCGGCCCATATGGTGGAGCCCAGCCCTCAGCCT
CGGCCCTTTCCTCCTATGGGGGTCAGGCAGCTGCAGCTTCTTCGCTCAACTCCTATGGGG
CTCAGGGTTCCTCCCTTGCCTCCTATGGTAACCAGCCATCCTCTTACGGCGCCCAGGCTG
CCTCTTCCTATGGGGTTCGTGCAGCTGCTTCTTCCTACAACACCCAGGGAGCAGCTTCCT
CCTTAGGCTCCTACGGGGCTCAGGCAGCCTCCTATGGGGCCCAGTCTGCAGCCTCCTCAC
TAGCTTATGGAGCCCAGGCAGCTTCATATAATGCCCAGCCCTCGGCCTCTTACAATGCCC
AGTCTGCCCCATATGCTGCACAGCAGGCTGCTTCCTACTCTTCCCAACCTGCTGCCTATG
TGGCACAGCCAGCCACAGCTGCTGCCTATGCCAGCCAGCCAGCAGCCTACGCCGCACAAG
CCACTACCCCAATGGCTGGCTCCTATGGGGCCCAGCCGGTTGTGCAGACCCAGCTGAATA
GTTACGGGGCCCAAGCATCAATGGGCCTTTCAGGCTCCTATGGGGCTCAGTCGGCTGCTG
CGGCCACTGGCTCCTATGGTGCCGCAGCAGCCTACGGGGCCCAACCTTCTGCCACCCTGG
CAGCTCCTTACCGCACTCAGTCATCAGCCTCATTGGCTGCTTCCTATGCTGCCCAGCAGC
ATCCCCAGGCTGCTGCCTCCTACCGCGGCCAGCCAGGCAATGCCTACGATGGGGCAGGTC
AGCCGTCTGCAGCCTACCTGTCCATGTCCCAGGGGGCCGTTGCCAACGCCAACAGCACCC
CGCCGCCCTATGAGCGTACCCGCCTCTCCCCACCCCGGGCCAGCTACGACGATCCCTACA
AAAAGGCTGTCGCCATGTCGAAAAG
gtactgtatgcccccccgcctctgcccccagctggggcttagggcaaggggctgaggttg
gcatgggagggaaactggaggcatcggcccctccctcggtcttctcttctctatttttgt
gggatgtccagaggccgaggggagcagtgtctatgaactttcctggtcaccagggttcag

 1.03 Term +  11020  11227  208  1  1  110   49   238 0.987  18.91
gaagccaggcttgatttttttggcctggatagggtgatgagccttctgacaaaaggagac
caatctcttggagaccactgtgatcacaccctccctgtccccattggcatctccccaatg
cccacctggagtcctcccctcaattgtctcattcaccaactgtcttcttctctcgactag
GTATGGTTCCGACCGGCGTTTAGCCGAGCTCTCTGATTACCGCCGTTTATCAGAGTCGCA
GCTTTCGTTCCGCCGCTCGCCGACAAAGTCCTCGCTGGATTACCGTCGCCTGCCCGATGC
CCATTCCGATTACGCACGCTATTCGGGCTCCTATAATGATTACCTGCGGGCGGCTCAGAT
GCACTCTGGCTACCAGCGCCGCATGTAG
ggccatcctgggatggggcaccacagggagggagggagaaaagaggtgggtagggttaca
gatccaggttataactactctggcccatacctttcctggttgtggtttttcatgccctct
accatgtgggccttccccaggagatgatcctgttaagtgttcggcagtaacctactttgt

Predicted peptide sequence(s):


>RBM14_1|GENSCAN_predicted_peptide_1|669_aa
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHEL
RPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHME
KEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGG
FSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQ
PSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAAS
SLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRA
AASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQ
QAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASM
GLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASY
RGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSK
RYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQ
MHSGYQRRM