GENSCAN 1.0	Date run: 15-Jan-104	Time: 01:48:01

Sequence RAD9A_1 : 8859 bp : 59.48% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1294   1327   34  0  1   95   96    63 0.785   7.94
tgcgccgtcacgtgacggcagagcctgtgagcgtttttctcacgtgacggaggcgcctgc
acgtggaccaatggggaggcgggggcggggccggcaggggcggtgcgcgggaagggaccc
cggacccggaggtcgcggagagctgggcagtgttggccgctggcggagcgctggggcagc
ATGAAGTGCCTGGTCACGGGCGGCAACGTGAAGG
gtgagtgcaggtcggcctggcagcggcggtgcagcagccgcggagccgccagcctaaccc
ccttccgctcttctccccgcagtgctcggcaaggccgtccactccctgtcccgcatcggg
gacgagctctacctggaacccttggaggacggggtgaggggctagggtgtggggggcggg

 1.02 Intr +   1410   1480   71  1  2  149   60   165 0.999  19.85
accccggacccggaggtcgcggagagctgggcagtgttggccgctggcggagcgctgggg
cagcatgaagtgcctggtcacgggcggcaacgtgaagggtgagtgcaggtcggcctggca
gcggcggtgcagcagccgcggagccgccagcctaacccccttccgctcttctccccgcag
TGCTCGGCAAGGCCGTCCACTCCCTGTCCCGCATCGGGGACGAGCTCTACCTGGAACCCT
TGGAGGACGGG
gtgaggggctagggtgtggggggcgggtgggactccagccgggagcgggtaacccggact
agagtctcgcccccactaggcgggatgaccgctggcagatttgtcggcaaagtttcagtt
tcttagtctggcggctgtcatcttcccaggccggtgtgtgaattgaggaaagctgtcctg

 1.03 Intr +   1903   2031  129  0  0   86  100   130 0.931  16.07
tcctctgcggcagcagcgccggggccgactctgaaggcttccatggggaaaggagggttt
ttcagcaggtggtggcggagcgggaggacgatagggcaagtgtgtgagcagaagcagcca
gagggctgggtctgtggctgccccctgaccacgtccctctccctgctcttcgtggcccag
CTCTCCCTCCGGACGGTGAACTCCTCCCGCTCTGCCTATGCCTGCTTTCTCTTTGCCCCG
CTCTTCTTCCAGCAATACCAGGCAGCCACCCCTGGTCAGGACCTGCTGCGCTGTAAGATC
CTGATGAAG
gtgaggcccttccctcagcagtggcactactccaccccaggaatctccaccagctgtgcc
tctgccctggggtactcagtagatgctaagtggggagagagacacgtgcaagcccaatcc
atgcaaaacacagggagggccatggtaaaagcatcacagcggggacctgagagggtggtg

 1.04 Intr +   2745   2859  115  2  1   37  109   164 0.972  14.59
ggcattccaagcataaggaagagcatgaatgaggcctagaaggatgccagtgcccgaggt
gacgtgggagcccttttcccagagttacatgctgggcccatgatgggtgtgggcctgcat
gggacaggagagcttgttgcagagatgtgatgctaggctgaggtgtcttatcccatgcag
TCTTTCCTGTCTGTCTTCCGCTCACTGGCGATGCTGGAGAAGACGGTGGAAAAATGCTGC
ATCTCCCTGAATGGCCGGAGCAGCCGCCTGGTGGTCCAGCTGCATTGCAAGTTCG
gtgagtgggcagccggccagccaaggggtgcctcagcagggaggtcggcgaggcccactg
agaccctatcgcccatccaggggtgcggaagactcacaacctgtccttccaggactgtga
gtccctgcaggccgtcttcgacccagcctcgtgcccccacatgctccgcgccccagcacg

 1.05 Intr +   2940   3039  100  1  1   63  101   114 0.983  10.53
ttccgctcactggcgatgctggagaagacggtggaaaaatgctgcatctccctgaatggc
cggagcagccgcctggtggtccagctgcattgcaagttcggtgagtgggcagccggccag
ccaaggggtgcctcagcagggaggtcggcgaggcccactgagaccctatcgcccatccag
GGGTGCGGAAGACTCACAACCTGTCCTTCCAGGACTGTGAGTCCCTGCAGGCCGTCTTCG
ACCCAGCCTCGTGCCCCCACATGCTCCGCGCCCCAGCACG
gtgagcacacccctgccctcagctcagccccgggtctctctcttccttctttggggcccc
aaggggttgattttagaaggtacctctttcattttccctacagagtttctgtgaacctca
aagacatcccatggcccgctatgtgctcaggtccttacctggctctttaaaggcagacgg

 1.06 Intr +   4965   5074  110  0  2   73   94   146 0.944  14.79
caggtttgagcaaccactgcaaccagtcccctccctgccaccttctctgggcctcatcca
cggtgcgctaggcctgcgcacatccgtgcgtgtgcatgtgtcacccccacctcaggtcct
ccgagagcaaagccctgggcagggccaggcatttcgggtaatgctccaccctgttcacag
GGTTCTGGGGGAGGCTGTTCTGCCCTTCTCTCCTGCACTGGCTGAAGTGACGCTGGGCAT
TGGCCGTGGCCGCAGGGTCATCCTGCGCAGCTACCACGAGGAGGAGGCAG
gtgagggggctggacgtggcctgggacagcagagtggcaggtgggagaggggcggggccc
aggttactcctgttcttccccaacagacagcactgccaaagccatggtgactgagatgtg
ccttggagaggaggatttccagcagctgcaggcccaggaaggggtggccatcactttctg

 1.07 Intr +   5161   5270  110  2  2   98   76   122 0.998  13.17
gttctgcccttctctcctgcactggctgaagtgacgctgggcattggccgtggccgcagg
gtcatcctgcgcagctaccacgaggaggaggcaggtgagggggctggacgtggcctggga
cagcagagtggcaggtgggagaggggcggggcccaggttactcctgttcttccccaacag
ACAGCACTGCCAAAGCCATGGTGACTGAGATGTGCCTTGGAGAGGAGGATTTCCAGCAGC
TGCAGGCCCAGGAAGGGGTGGCCATCACTTTCTGCCTCAAGGAATTCCGG
gtgaggttcctcccaggcgctcgccgtcctgtcctccctgcccagctcagcccagcccgg
ggcctcacctgctacctctttcctcccaggggctcctgagctttgcagagtcagcaaact
tgaatcttagcattcattttgatgctccaggcaggtagttcccagccttgggacagggaa

 1.08 Intr +   5360   5424   65  1  2  143   68    14 0.997   3.56
ggtgactgagatgtgccttggagaggaggatttccagcagctgcaggcccaggaaggggt
ggccatcactttctgcctcaaggaattccgggtgaggttcctcccaggcgctcgccgtcc
tgtcctccctgcccagctcagcccagcccggggcctcacctgctacctctttcctcccag
GGGCTCCTGAGCTTTGCAGAGTCAGCAAACTTGAATCTTAGCATTCATTTTGATGCTCCA
GGCAG
gtagttcccagccttgggacagggaagggctctgggatggcaggagctgaatgggatgac
ctagcttgggccccctcccctgcccaggcccgccatcttcaccatcaaggactctttgct
ggacggccactttgtcttggccacactctcagacaccgactcgcactcccaggacctggg

 1.09 Intr +   5512   5649  138  1  0   92   94   180 0.999  19.76
gcctcacctgctacctctttcctcccaggggctcctgagctttgcagagtcagcaaactt
gaatcttagcattcattttgatgctccaggcaggtagttcccagccttgggacagggaag
ggctctgggatggcaggagctgaatgggatgacctagcttgggccccctcccctgcccag
GCCCGCCATCTTCACCATCAAGGACTCTTTGCTGGACGGCCACTTTGTCTTGGCCACACT
CTCAGACACCGACTCGCACTCCCAGGACCTGGGCTCCCCAGAGCGTCACCAGCCAGTGCC
TCAGCTCCAGGCTCACAG
gtgagggcacctccccccaactcctcctctctccatgtctgtgcactccagcctgagact
gcaactcctagcttctgcacctccccgcaatgtgttctctcccgccccttctctttctat
caggccccagcccctaaccctatagtgctcacagctgccagccctgcagactcagccttc

 1.10 Intr +   6428   6635  208  2  1  104   97   228 0.906  25.60
ccccctccaggaagtcaccacttaacccctgcatcctctcctctccagccaaatcaggaa
gtcataaaaccaagagatctccagtggtcgggggccccagagctcccttcgagccctcca
aggtggggccctgcctctgctcccccagtcccctccctgatactccgattctgcctacag
CACACCCCACCCGGACGACTTTGCCAATGACGACATTGACTCTTACATGATCGCCATGGA
AACCACTATAGGCAATGAGGGCTCGCGGGTGCTGCCCTCCATTTCCCTTTCACCTGGCCC
CCAGCCCCCCAAGAGCCCCGGTCCCCACTCCGAGGAGGAAGATGAGGCTGAGCCCAGTAC
AGTGCCTGGGACTCCCCCACCCAAGAAG
gtagggactggaggtggaggcaggggtgggaggtagggaagggagcagcctccagaactc
acttgttctctttccagttccgctcactgttcttcggctccatcctggcccctgtacgct
ccccccagggccccagccctgtgctggcggaagacagtgagggtgaaggctgaaccaaga

 1.11 Term +   6713   6808   96  1  0   69   46    84 0.722   1.19
cctttcacctggcccccagccccccaagagccccggtccccactccgaggaggaagatga
ggctgagcccagtacagtgcctgggactcccccacccaagaaggtagggactggaggtgg
aggcaggggtgggaggtagggaagggagcagcctccagaactcacttgttctctttccag
TTCCGCTCACTGTTCTTCGGCTCCATCCTGGCCCCTGTACGCTCCCCCCAGGGCCCCAGC
CCTGTGCTGGCGGAAGACAGTGAGGGTGAAGGCTGA
accaagaacctgaagcctgtacccagaggccttggactagacgaagccccagccagtggc
agaactgggtctctcagccctggggatcagaaaggtgggcttgctggagctgagctgttt
cactgcctctcgcaggccccagctggctgtcactgtaaagctgtcccacagcggtcgggc

 2.04 PlyA -   7455   7450    6                               1.05
 2.03 Term -   7894   7784  111  1  0  101   41   196 0.999  15.69
 2.02 Intr -   8105   7971  135  2  0   83  109   284 0.999  31.95
 2.01 Intr -   8412   8189  224  1  2   79   80   383 0.989  35.67

Predicted peptide sequence(s):


>RAD9A_1|GENSCAN_predicted_peptide_1|391_aa
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSTPHPDDFAN
DDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKK
FRSLFFGSILAPVRSPQGPSPVLAEDSEGEG

>RAD9A_1|GENSCAN_predicted_peptide_2|156_aa
XLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAK
FLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQ
ILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK