GENSCAN 1.0	Date run: 15-Jan-104	Time: 02:00:31

Sequence RAB6A_1 : 87558 bp : 41.60% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    788    920  133  2  1  152   92    78 0.823  14.33
agaagggatctgaggactgtgaggcacggctgagggctcaggaaagaggctcccattaca
aattttaaggctataggaccccacccacactttttgggggatcatattccacctttgtcc
cggccccgcctccgccccacccttctccccctcccctttctttccttcccctcccctcag
GCTGAGAGGCGCCACACTTCTTATGGCCGCCACAGTGCTCCGCTTTCCACAGCTCGAGGG
CTGCGCGCGCTCTCACGCTGCCACCTCACTCGCGTGTGGGCTCGCCCTCAGCCCCTTCCG
ATTGGCTCATTAT
gtaagtgacgtaagggctccagcctcccactaacttatccctggcttgccccgcctcctc
ctggcttcttttgacgccagtggaaacctaacctgccccgtcgccgccgtgcgggaggag
ccggtagagctgtccaaaccaggaaggcgatggcgatggcggtggcgcgcacgcatgcac

 1.02 Intr +   1001   1234  234  1  0   62   40   177 0.913   7.26
agtgctccgctttccacagctcgagggctgcgcgcgctctcacgctgccacctcactcgc
gtgtgggctcgccctcagccccttccgattggctcattatgtaagtgacgtaagggctcc
agcctcccactaacttatccctggcttgccccgcctcctcctggcttcttttgacgccag
TGGAAACCTAACCTGCCCCGTCGCCGCCGTGCGGGAGGAGCCGGTAGAGCTGTCCAAACC
AGGAAGGCGATGGCGATGGCGGTGGCGCGCACGCATGCACGCACGCACGCACGCCAGCGG
CCGGCGGGGCCGCAGGCTCGCGCCCGGGCTCGCCCCGCGCCGCTCCAGAGGCTCGCGCAC
TCAGCAGGTTGGGCTGCGGCGGCGGCGGCAGCTGTGGAAGCTCAGGCGCTGCGC
gtgagaggtcccagatacgtctgcggttccggctccgccaccctcagcttctcttcccca
ggtctgggagccgagtgcggaaggagggaacggccctagctttgggaagccagaggacac
ccctggctcctgccgacaccgccctccttcccttcccagccgcgggcctcgctcggtgct

 1.03 Intr +   1417   1568  152  0  2   53   18   139 0.510   1.44
gagaggtcccagatacgtctgcggttccggctccgccaccctcagcttctcttccccagg
tctgggagccgagtgcggaaggagggaacggccctagctttgggaagccagaggacaccc
ctggctcctgccgacaccgccctccttcccttcccagccgcgggcctcgctcggtgctag
GCTACTCTGCCGGGAGGCGGCGGCGGCTGCCAGTCTGTGGAGAGTCCTGCTGCCCTCCAG
CCGGGCTCCTCCACCGGGCCTTGCAGGGGCCGAGAGAGCTCGGTGCCCGCCCTTCCGCTC
GCCTTTTTCGTCAGCTGGCTGGAGCAGCATCG
gtccgggaggtctctaggctgaggcggcggccgctcctctagttccacaatgtccacggg
cggagacttcgggaatccgctgaggaaattcaagctggtgttcctgggggagcaaagcgg
tgagtgcgtggctcccctactcctggcagctggccgcagcgtccccgcaccgcccccggt

 1.04 Intr +   1611   1879  269  0  2   34  -14   241 0.379   4.75
aggcggcggcggctgccagtctgtggagagtcctgctgccctccagccgggctcctccac
cgggccttgcaggggccgagagagctcggtgcccgcccttccgctcgcctttttcgtcag
ctggctggagcagcatcggtccgggaggtctctaggctgaggcggcggccgctcctctag
TTCCACAATGTCCACGGGCGGAGACTTCGGGAATCCGCTGAGGAAATTCAAGCTGGTGTT
CCTGGGGGAGCAAAGCGGTGAGTGCGTGGCTCCCCTACTCCTGGCAGCTGGCCGCAGCGT
CCCCGCACCGCCCCCGGTGCGGCCCTTCCGTCCGCGGAGGCTCCCTGCCCGCCTCGCGTC
CGCGCTCGTTGCCACCGCAGCCCTTCCCGATGTGCCCCCCGGTGCCACTGGCTCTTCGCC
AGTGGCCGAGTTTTTACCCTGTTCCCCGG
gttcttcaatcctcgactccccggctccgttccccgcagtccggccatctccggtcgatc
tgccctccctccccagacctcaccccgcccagcctcttgtccatccctttcttcctccgg
tctcggtcattgcccgtaccccggccccctttcttgagccccacccttattccttgctct

 1.05 Intr +   2068   2205  138  2  0   95   81    93 0.486   8.81
atcctcgactccccggctccgttccccgcagtccggccatctccggtcgatctgccctcc
ctccccagacctcaccccgcccagcctcttgtccatccctttcttcctccggtctcggtc
attgcccgtaccccggccccctttcttgagccccacccttattccttgctcttttcccag
TTCCTCAGCTCTGTGAGGCCCACTCAGGGAAGCCCCACTCCCGAGAGCGGGCCCTCTTCA
ACCTTGGCCAAGGAGGGTGGGATCTGGGCGTTGTTTTCCCCAGAGGCTTGGCCCTGCGAA
GTGCTGATGTCGTGGAAG
gtgggaaggggtggtagtagaaaaaattaaatgattttcacctgggtgggaaattagtct
gggccatagaggaaacatctgaattggagacgacttgagcatggggtggttgggggtgaa
aggggtagcgtcggcagtggagatttttgccccttaggttagatggggctgtggcttgtc

 1.06 Term +   4171   4238   68  2  2  109   38    -3 0.255  -6.08
ggatgtgaagttaattatcttttgaggttactatattgtcaagtaatgccattcattagc
tttgacaatgaaagattgatctctgttttcatggtcagtgtctatagttttcttatgcgt
tagaagtctgtagactccatgtccttttgatgtaactcttcatgaattatttatttttag
GTCTGTTAGAATTCCACAATTCAGCTTTCAAAGACTGTAATCTATGGCAAAGCCTTGTTT
CTTCTTAA
tagcatttaccacatttacaattatcttattttttatgtgtttgtttttatttcccacag
aagaatgcaactcccatgaagataaaaactattcttttttgttcagtgtgtccccattgc
ctagcgtagagccaggctcatagtagctgttcagacatgttgggtaaatgaatgatggct

 2.03 PlyA -   4657   4652    6                               1.05
 2.02 Term -   6510   6298  213  0  0  -20   42   422 0.539  23.05
 2.01 Init -  31273  31226   48  1  0   82   97     3 0.190   1.60
 2.00 Prom -  36269  36230   40                              -6.35

 3.01 Init +  40219  40299   81  0  0   90   43    48 0.548   1.52
tacaaaacactgctgggagaaattaaaggagacacatgtattagtttgttctcatgctgc
taataaagagataacccaagactgggtaatttataaaggaaagaggtttaatagactcaa
gttccacatggctggggaggcctcaggaaacttacaatcatggcagaaggggaagcaaac
ATGTCCTTCTTCACATGGCAGCAACAAGGAGAAGCACAGAGCAAAGAGAGGGGAAATCCT
TTTATAAAACCATCAGATCTC
gtgagaactcaactatgacacacacaaaattctatttttctgctaacagaaataaaatcc
ccaactgatggaccacttttctgatctagtttttgattgttttttaggaacttaaaattc
ttagtgactcatattttaaaatgcacagactcagtttctgttttaaggaatatggcacaa

 3.02 Intr +  41354  41407   54  1  0  126   79    33 0.683   4.46
tgaatacatgaaaatcattatcactggaaattttgtttgtccttaattgtccttaattga
ctatgttgtattgatttgtttattcattatttcttccacaatcatgaatcccatttgaat
cctaaactgctggccaccattaaacttattatttgttaacttctttgttttgttttacag
GCAACAATTGGCATTGACTTTTTATCAAAAACTATGTACTTGGAGGATCGAACA
gtgagtaatattttcagtgtgcaattttctgcaacattccaggttagaaaactgcaatca
aagttatcaatgattgtcaccataagaagtacttagcaaagttaccaaagatagtttaca
gttgttgagaaaaactcttattaccgagtgagtagtacttggcagtcatcttgatttgga

 3.03 Intr +  43363  43468  106  0  1   90   58   136 0.727   9.67
ttctcccttttgaaaaaggagttttgtgttattttcattcctcactccctgcaacctctt
gcatgagtcttctttctacttccttcccaccctctcccttttacaaaaaacattgtttct
tttttctttttagtattagtttggtttttttttttttatttattttttcccatctcacag
ATCAGGCTTCAGCTGTGGGATACTGCGGGTCAGGAACGTTTCCGTAGCCTCATTCCCAGT
TACATCCGTGATTCTGCTGCAGCTGTAGTAGTTTACGATATCACAA
gtaggtatattgcaacgggttgacctttcttatttttcttgcttgtttgactgattttgt
tgttaggtacgattgcaattatgggacacagcaggtcaagagcggttcaggagcttgatt
cctagctacattcgtgactccactgtggcagttgttgtttatgatatcacaagtgagtgg

 3.04 Intr +  45891  46002  112  1  1   89   64    91 0.669   5.32
gtttaaattgctgacagttgtaatcagataaaatggagttatgttgcaggcacattaaaa
gtggggtactaatgtgccagcccccttccaacttccagggcttttttggagggaggtgcc
caccacctggggaggcatttttcagcaacactaatctctctgtctaccctcctatactag
ATGTTAACTCATTCCAGCAAACTACAAAGTGGATTGATGATGTCAGAACAGAAAGAGGAA
GTGATGTTATCATCATGCTAGTAGGAAATAAAACAGATCTTGCTGACAAGAG
gtatggagttattttatatgtgtgtaatgtttgatttctgtgatgcagccttttattttt
gttcactgagaaattgttttgaaaggagacatgcttaatccttaagtttacgtcctcccc
tgcttttctttagcatgggaacctcaaatataaatgtaaatattaaacagccagtcctta

 3.05 Intr +  54740  54833   94  2  1   73  111    84 0.768   8.25
agtatacacacacagaaacacacaaatttcaagagtgtggcagattaatgaatttttaaa
ctaatgtgacctgtataaccagtccttatatcaaggaaagttattttcagagctttcttt
ataatctttataatactgcctcatgtctcaaaagtaagaagtttgtttgtttctttacag
GCAAGTGTCAATTGAGGAGGGAGAGAGGAAAGCCAAAGAGCTGAATGTTATGTTTATTGA
AACTAGTGCAAAAGCTGGATACAATGTAAAGCAG
gtaagttgagttgaggttaccaaattgaaaaaatatgaaataattgtgtgagtattctat
tctctggtgtataggtttccttccacctggcaagagcaggccttacaaactagcagtata
ttttcaaacagtgaaaaatataaatgtggcatagtttttggaaaaagagaaaagacttgc

 3.06 Term +  82533  82637  105  2  0  133   41    64 0.126   3.63
ctggtctcaaactcctgacctcaagtgatctgcccacctcgggtgggtcccaaagtgctg
ggattacaggtgtgagccactgcgcccagcattagacagctcactgtacagtgatcataa
acctcagtaccctttgctaaatgttccctctcagttatcacttttctctctttcccacag
CTCTTTCGACGTGTAGCAGCAGCTTTGCCGGGAATGGAAAGCACACAGGACAGAAGCAGA
GAAGATAGTATCCTTTTTATTTCATTGGAAATTTTTCATTATTAA
cactagtctttagagccctgcttgcttggctaaagaatattgtgccattgccttttacaa
ccaggaactgatgacttaaaggcatagaaattcatttgttttctatagcaaatgaggtct
ggttatccaagtgcaccctttgcagcctgcttctcgttgttaatcagtgagaggttttgt

Predicted peptide sequence(s):


>RAB6A_1|GENSCAN_predicted_peptide_1|331_aa
XLRGATLLMAATVLRFPQLEGCARSHAATSLACGLALSPFRLAHYWKPNLPRRRRAGGAG
RAVQTRKAMAMAVARTHARTHARQRPAGPQARARARPAPLQRLAHSAGWAAAAAAAVEAQ
ALRATLPGGGGGCQSVESPAALQPGSSTGPCRGRESSVPALPLAFFVSWLEQHRSTMSTG
GDFGNPLRKFKLVFLGEQSGECVAPLLLAAGRSVPAPPPVRPFRPRRLPARLASALVATA
ALPDVPPGATGSSPVAEFLPCSPVPQLCEAHSGKPHSRERALFNLGQGGWDLGVVFPRGL
ALRSADVVEGLLEFHNSAFKDCNLWQSLVSS

>RAB6A_1|GENSCAN_predicted_peptide_2|86_aa
MTFSKHRQPSPNLKAQKGEGNGKRKGGRKGEKERKGEVERGKEGRRGKEEKEEEEEEEEQ
EEEEKEEEEEEEEEEKEEEEEEEEQQ

>RAB6A_1|GENSCAN_predicted_peptide_3|183_aa
MSFFTWQQQGEAQSKERGNPFIKPSDLATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFR
SLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQV
SIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDSILFISLEI
FHY