GENSCAN 1.0	Date run: 15-Jan-104	Time: 01:13:08

Sequence PRG2_1 : 5664 bp : 48.45% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1877   1946   70  1  1  123   97    -2 0.760   2.95
gcgtcctggatcctggagcatcaggagctgggcttggcatgagcttttctggcccatcct
gatttctattcaggccttctttttctccacctcactcccacggtcccctaatggtgtgat
tgtgatgtgtgtgcatgtgtgtctgtgtgtgtcaatgacaaactgtgttctccgttgcag
GATAAAGCCAAGATGAAACTCCCCTTACTTCTGGCTCTTCTATTTGGGGCAGTTTCTGCT
CTTCATCTAA
gtaagtgttttttgccttcagtctttctttctctgttttttccctttctatggtagatgg
ggtcagagttacacacccacccccttctttgatcgtcttctatttctgaatttctgtgtg
cttaaagggatggggactctatggccaggagttgaaaggatttctcaaggcgtctgttat

 1.02 Intr +   2516   2823  308  0  2   39   92   359 0.841  27.57
ttaaccaccttgaccttgtcaggcagcttgggttcccctcatagagactgggttccaggt
tccccttcccaggcagagttgagcactctgatgcccagggcaaggtgtgagctgtctgtg
gttctggggaggaacaaggggagatgtgaaggaaggacacttagctatcctccctgccag
GGTCTGAGACTTCCACCTTTGAGACCCCTTTGGGTGCTAAGACGCTGCCTGAGGATGAGG
AGACACCAGAGCAGGAGATGGAGGAGACCCCTTGCAGGGAGCTGGAGGAAGAGGAGGAGT
GGGGCTCTGGAAGTGAAGATGCCTCCAAGAAAGATGGGGCTGTTGAGTCTATCTCAGTGC
CAGATATGGTGGACAAAAACCTTACGTGTCCTGAGGAAGAGGACACAGTAAAAGTGGTGG
GCATCCCTGGGTGCCAGACCTGCCGCTACCTCCTGGTGAGAAGTCTTCAGACGTTTAGTC
AAGCTTGG
gtgagtggcctatggctgaggctgaggtgggagcatggaacgggtgtgggatatgccccc
agcattgctatcactggctctttttcccattgagggccctgggggtgtcagtagaacctg
agcctcagagaggtgttggggtaagaggggagggccacctacaaacagaagttgcatttt

 1.03 Intr +   3125   3256  132  1  0   61  103    94 0.997   9.04
gcctcagagaggtgttggggtaagaggggagggccacctacaaacagaagttgcattttg
gtctccaaccttcaaatggttgtggcaggggagggagggaatgaattgtggggactcaag
acccatgtgaattcatgtaggaaggatgctccattctttgtcttttatcctgccctgtag
TTTACTTGCCGGAGGTGCTACAGGGGCAACCTGGTTTCCATCCACAACTTCAATATTAAT
TATCGAATCCAGTGTTCTGTCAGCGCGCTCAACCAGGGTCAAGTCTGGATTGGAGGCAGG
ATCACAGGCTCG
gtaagagaagtgtgaacactaaatggggtgcacctgctgatctcagccagcactcagctt
gcatcagatttgtctgtttttctcctgtataatctccagaagaaccagggatagatggac
acccacagacaacactgagggggctgcctgggcattcagggaagagctaaggatttagaa

 1.04 Intr +   3968   4079  112  1  1  123   78    71 0.326   9.55
tctgatggtgataattgccgtggatcagcatttcagatgactaggacagttcccatcatg
gtccagcagggaagggcccattgcccggtgggcagcagaaagagctggcagatacggggc
caggtctgcttctctgccttccctctgccccatcccttcttcccctcttgctttctccag
GGTCGCTGCAGACGCTTTCAGTGGGTTGACGGCAGCCGCTGGAACTTTGCATACTGGGCT
GCTCACCAGCCCTGGTCCCGCGGTGGTCACTGCGTGGCCCTGTGTACCCGAG
gtgaggtggggctggggatgaacgatggaaaggtctgggagatgggaagtgccccaagga
ggagatgctacaaagagcctgaccctttgtgggagaggcttcctgggtcttttatatact
ctgactccacagcagtgtgtgggtgggaaaagaggccctcctgtgggttgagttgggatg

Predicted peptide sequence(s):


>PRG2_1|GENSCAN_predicted_peptide_1|208_aa
DKAKMKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEE
EEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQ
TFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVD
GSRWNFAYWAAHQPWSRGGHCVALCTRX