GENSCAN 1.0	Date run: 15-Jan-104	Time: 00:08:26

Sequence PAX6_1 : 23681 bp : 49.26% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1436   1590  155  0  2   -9  113   108 0.602   3.39
gccggcacacacacattaacacacttgagccatcaccaatcagcataggtgtgctggctg
cagccacttccctcacccacactctttatctctcactctccagccgctgacagcccattt
tattgtcaatctctgtctccttcccaggaatctgagaattgctctcacacaccaacccag
CAACATCCGTGGAGAAAACTCTCACCAGCAACTCCTTTAAAACACCGTCATTTCAAACCA
TTGTGGTCTTCAAGCAACAACAGCAGCACAAAAAACCCCAACCAAACAAAACTCTTGACA
GAAGCTGTGACAACCAGAAAGGATGCCTCATAAAG
gtgagtccgcttctttcttctcgctttatttttattgcaatattcagacaggtctccccc
ttcctccccccttccttcctcccctctcgccggtcccctcccccactgctacgccgggag
agttgggccggagaagtttccacgcaggagcccaaactttctacttccagcgaaagcccg

 1.02 Intr +   1711   2253  543  0  0  -41   65   459 0.536  23.79
ccccaaccaaacaaaactcttgacagaagctgtgacaaccagaaaggatgcctcataaag
gtgagtccgcttctttcttctcgctttatttttattgcaatattcagacaggtctccccc
ttcctccccccttccttcctcccctctcgccggtcccctcccccactgctacgccgggag
AGTTGGGCCGGAGAAGTTTCCACGCAGGAGCCCAAACTTTCTACTTCCAGCGAAAGCCCG
CGTCGGAGGGCGACTGCCGGCGAGCGGGAGCGGCGCAGGGCTCGGGGCGGGCGGCCAGCT
CAGCCCCAGCGCCAGCGCCAGCGCCAGCGCGGGCTGAGCTCGCGGGAAGAAGGGAGACTC
CAGGCGCGACAGCAGCCGCGGCTCCTAGCCCCAGCGTCGCCCAATGCTCCCGACCCGCGG
GAAAAGACGAAGAGGCTCTGTGGTGCCCAAGGCCCTGGAACGGCCGCAGAGAGCAACCGC
TGCCGGCTGCTTTGTCCAGCCCGAGGCCCAGCGAACGCGCAGAGAGCGGGCGCTCCGAGG
ACTCGCCGAGGGAGCGCCGAGGGAACCTGCTCGCCGCGTCTCCGCCCGCCCGCCGGCCCT
CGGGCTTTGTGCCGCACTGGGCTCCGGCGCAGAAGAGTCAGCCGGCACTCGAGCGCCGAG
GGGGGCACCGCGCCCGCCACCAGCCCGAGTGGAGTCAGTCGGCAAGGCAGCCGCACGCTG
GAG
gtagagggaagagcgagctagcgcgagccgggaaggaagccaccaggccaaggcggtgga
acgcgcgctccgagggagctcagagccgagcgggaggactgtcagcttccacccagcccc
cgggctcttgcccccaactccactggagcgctgagctcggaacttgaaaactctctgctc

 1.03 Intr +   5956   6016   61  0  1   96   98    38 0.916   3.91
agattttgtatgcactgcagggcagagctgagtgaccctcagatcgccccaagaggttga
gtggatcaattcctaaagaacggagattctcctgtcctagccccaggtccacctcggttg
ggagttcaggcctacctgatgcagctgcccgaggattaactcctattttcttgctaacag
AGCCCCATATTCGAGCCCCGTGGAATCCCGCGGCCCCCAGCCAGAGCCAGCATGCAGAAC
A
gtaagtgcctctggtctttctgggacttcgggctcggggtgcgcggacccgagggtcagg
ggaggacacagggactcgcgacgcccgcgctggcccggccgccgaccgactgaggcccgg
ggacctgcggcggctgctccccgctccgcgcccggcagcccgggaggggagggcgtttgc

 1.04 Intr +   6745   7029  285  2  0   92  107    50 0.900   4.61
ggtaaactcgctgttacagggcgcgggagagagcacggtttactgggtctggtaaggagg
tgcccaggaattggaaaatccctgccctggcaactgcaattgcttgggtcctgatagtcc
caggcccagagcgcttttgatacttatggcccttgtacctccctgctttcctctgcccag
ACCCCGTGGGGTCCCACCCACCTTCCTGTTCGTGGTGGGTGCTGGTACGCGGCAGGGCTA
GTCTAGAGCTCCGACCTGGGAGCCTGGAGGCCCAGCGAAACCAGGCCCGGTTTGAGGTTA
CGGTTGAGGCACACGGCGTCGGGGCTCAACTGAACTCAAAGTGTGGAAAGGCCCGGGTCT
TCCAGCAGCCTGCCCTGGCCGAACCACACAGGCTTAAGGAGGGTCCCCAGCACCTTATCC
ATCTGTTTTGGAAACGCCGGTCGCCCCCTGGTGCTTCCGGGGCTG
gtaagcgcgtagctgaggaaagggcacaaaggtggcgagctttgcgggagtagttgtgca
gaacctgccggaccccagggcttggccggtaggctcgccttcggcggctgggctctcccc
ttggagctcagactccccagccgcaggctgtctctcgggcgggccccagccagggcgcgc

 1.05 Intr +   9282   9398  117  1  0   71   52    55 0.567   0.64
tcagaggggatctttgggagatttatagagccggttcttagcgctttgtgggttcagagg
ctggctgcagtgtttatgaagaggggcagtgggctggggacactgctggggttatggctg
tagtgaggtccatgtgtacttgttccttggcatgtgtctgactctgtgttgctgctgcag
TACAGTGGGCAGGGGCACGGTTGCTTGGACTGGGCTGCCCGATGTCTGGCATGGCTGGTG
GTCCTGTTGTCCTTTATTTGATCGATAGCAGGGAACTGACCGCCGAGGTTGGCACAG
gttggcagggggatgaggatgcattgtggttgtctcctcctcctctccttcttcctcttc
cccttcctcctctcctttctgttcttgttctccctcatcttcctcttccttcttctccct
cttcttcctcttcactctgctctcttctcttcttttcccctttcctctcctctccctttc

 1.06 Intr +   9584   9714  131  0  2  141   58   149 0.999  17.61
cagggggatgaggatgcattgtggttgtctcctcctcctctccttcttcctcttcccctt
cctcctctcctttctgttcttgttctccctcatcttcctcttccttcttctccctcttct
tcctcttcactctgctctcttctcttcttttcccctttcctctcctctccctttcctcag
GTCACAGCGGAGTGAATCAGCTCGGTGGTGTCTTTGTCAACGGGCGGCCACTGCCGGACT
CCACCCGGCAGAAGATTGTAGAGCTAGCTCACAGCGGGGCCCGGCCGTGCGACATTTCCC
GAATTCTGCAG
gtgatcctcccggcgccgccccactcgccgcccccgcggccctccactctcaacgccctc
tcttcatttcttactgtaaacgatgctaattatggacccccccaccctcacccaccccag
tccccagtccccccacccactcccctgccttcccactttcccctctccttccaccatcct

 1.07 Intr +  10506  10547   42  2  0   62   85    51 0.608   0.64
ttcaggcagtgtttaagaaaagttttttttttaaaaaaagcttttaaattcgttttttag
ttcaaattgtttgaaagtatcatcatatttgtagtttttagggctacaaatgtaatttta
agaaaaaaagctctctacagtaagttctcataccattgaaggtatatttttgtgttatag
ACCCATGCAGATGCAAAAGTCCAAGTGCTGGACAATCAAAAC
gtaagcttgtcattgtttaatgcatacttaaacaattttatttttgtcttgaaattatta
ataatgtggttttctgtccacttcccctatgcaggtgtccaacggatgtgtgagtaaaat
tctgggcaggtattacgagactggctccatcagacccagggcaatcggtggtagtaaacc

 1.08 Intr +  10642  10857  216  0  0  104   94   112 0.995  12.10
acagtaagttctcataccattgaaggtatatttttgtgttatagacccatgcagatgcaa
aagtccaagtgctggacaatcaaaacgtaagcttgtcattgtttaatgcatacttaaaca
attttatttttgtcttgaaattattaataatgtggttttctgtccacttcccctatgcag
GTGTCCAACGGATGTGTGAGTAAAATTCTGGGCAGGTATTACGAGACTGGCTCCATCAGA
CCCAGGGCAATCGGTGGTAGTAAACCGAGAGTAGCGACTCCAGAAGTTGTAAGCAAAATA
GCCCAGTATAAGCGGGAGTGCCCGTCCATCTTTGCTTGGGAAATCCGAGACAGATTACTG
TCCGAGGGGGTCTGTACCAACGATAACATACCAAGC
gtaagttcattgagaacatctgccctccctgccctaagcccaatgctctctcctctttac
ctcctcccaccctctctctccactgtctcttagtctgtgtcctctccctgctccacattt
gtctcctttgtacctgggggaacagagaggaatgccctgacttttctttgactgtctgga

 1.09 Intr +  11562  11727  166  2  1   76   93    72 0.974   6.03
cccaaagtgatagctatcattttttccacggtgtatctgcaaatccacccactgtcccgg
ggtggctgggagctttttaacgggttgagagttgctttttaaggttgtgggtgagctgag
atgggtgactgtgtcttcaggagacactaccatttggtttgattttggtttgatttgcag
GTGTCATCAATAAACAGAGTTCTTCGCAACCTGGCTAGCGAAAAGCAACAGATGGGCGCA
GACGGCATGTATGATAAACTAAGGATGTTGAACGGGCAGACCGGAAGCTGGGGCACCCGC
CCTGGTTGGTATCCGGGGACTTCGGTGCCAGGGCAACCTACGCAAG
gtaaaacccaagcagccatccacgcagctctccatatgtgcatccctttgcctgtcccct
actctcccaaccatttcctctcagggcttccatgcttggggaatgtcatgggtgagactg
catttgaaggcctgggacacatcgaccacattgtatgtaggtggtgtttgttgaaccatt

 1.10 Intr +  11812  11883   72  2  0   88   42    58 0.553   0.58
atgataaactaaggatgttgaacgggcagaccggaagctggggcacccgccctggttggt
atccggggacttcggtgccagggcaacctacgcaaggtaaaacccaagcagccatccacg
cagctctccatatgtgcatccctttgcctgtcccctactctcccaaccatttcctctcag
GGCTTCCATGCTTGGGGAATGTCATGGGTGAGACTGCATTTGAAGGCCTGGGACACATCG
ACCACATTGTAT
gtaggtggtgtttgttgaaccattttgttggcctgggaatgtgagggttgtgtatgtcag
gagcggtatgaaggtggctggtgggtgcgtgtgtgtgtttgtgggcagcactgtgtgcat
aagaacgagctgcgtggtgcactattcaaatttgacattagaatgcagggagagccccct

 1.11 Intr +  17630  17788  159  0  0  108   54   194 0.919  17.96
tggtcaggtaactaacatcgcaaatgtatttttttaaaagaaggctgacagttaccttgg
gaatgttttggtgaggctgtcgggatataatgctcttggagtttaagactacaccaggcc
ccttttggaggctccaagttaatccaaatttctcttaccatcctattctttttgttccag
ATGGCTGCCAGCAACAGGAAGGAGGGGGAGAGAATACCAACTCCATCAGTTCCAACGGAG
AAGATTCAGATGAGGCTCAAATGCGACTTCAGCTGAAGCGGAAGCTGCAAAGAAATAGAA
CATCCTTTACCCAAGAGCAAATTGAGGCCCTGGAGAAAG
gtgatagagtttttcaaagtagagaagcagtaaatcaaagtaaatgccacatcttcagta
caaagagctaaatttagccagggccctttgcatagaagaatgaaaagatttccttttttc
tgtctttttatttctctgggcatcttttcagtgtgtgtgtgtgtgtgtgtgtgtgtgtgt

 1.12 Intr +  18304  18386   83  2  2   29   86    85 0.945   1.76
aaaatttaacttggttctggtgggaaagttcttccaagtacagtcaacactagaagcatt
ttaaagggaattggttggaggtaatgggagtggggaggtgggaaccagtttgatgcacag
tttggtcaacatattttgtgtagttctggcacaatatggaaaatcaacttactctttcag
AGTTTGAGAGAACCCATTATCCAGATGTGTTTGCCCGAGAAAGACTAGCAGCCAAAATAG
ATCTACCTGAAGCAAGAATACAG
gtaccgagagactgtgcagtttcacactttgtgattcataccatttgtctttcctagaga
cagaggtgcttgtacagagtactatttatttataggactaatataataaaaaggttcagt
ctgctaaatgctctgctgccatgggcgtggggagggcagcagtggaggtgccaaggtggg

 1.13 Intr +  18616  18766  151  0  1   72   58    76 0.958   2.74
tttcctagagacagaggtgcttgtacagagtactatttatttataggactaatataataa
aaaggttcagtctgctaaatgctctgctgccatgggcgtggggagggcagcagtggaggt
gccaaggtggggctgggctcgacgtagacacagtgctaacctgtcccacctgatttccag
GTATGGTTTTCTAATCGAAGGGCCAAATGGAGAAGAGAAGAAAAACTGAGGAATCAGAGA
AGACAGGCCAGCAACACACCTAGTCATATTCCTATCAGCAGTAGTTTCAGCACCAGTGTC
TACCAACCAATTCCACAACCCACCACACCGG
gtaatttgaaatactaatactacgaatcaatgtctttaaacctgtttgctccgggctctg
actctcactctgactactgtcatttctcttgccctcagtttcctccttcacatctggctc
catgttgggccgaacagacacagccctcacaaacacctacagcgctctgccgcctatgcc

 1.14 Intr +  18865  18980  116  2  2  113  108    94 0.977  14.07
agcaacacacctagtcatattcctatcagcagtagtttcagcaccagtgtctaccaacca
attccacaacccaccacaccgggtaatttgaaatactaatactacgaatcaatgtcttta
aacctgtttgctccgggctctgactctcactctgactactgtcatttctcttgccctcag
TTTCCTCCTTCACATCTGGCTCCATGTTGGGCCGAACAGACACAGCCCTCACAAACACCT
ACAGCGCTCTGCCGCCTATGCCCAGCTTCACCATGGCAAATAACCTGCCTATGCAA
gtaagtgcggctggtggtggcctgcataacccaggccccagagaagtgaggagtggctca
gggcctgcggacctcattggctgtgtctgcacccttgagagcttttcgcactacagtgat
tggcttgaccagtcaagtcggagacagtcaatcccatcacttttaagtgattgactcatt

 1.15 Intr +  21558  21708  151  2  1  115   99    80 0.991  11.54
ccagtggaaggactagctcgaggcccaatcttagatttatcatatggaattccagtactt
cacgtgaaggcatctttaatgatcagacttgttggcagagttcctcgggaggagggagcc
tggggctgtggctgtgtgatgtgttcctcagtaaccacaggtttgcctctctcctcacag
CCCCCAGTCCCCAGCCAGACCTCCTCATACTCCTGCATGCTGCCCACCAGCCCTTCGGTG
AATGGGCGGAGTTATGATACCTACACCCCCCCACATATGCAGACACACATGAACAGTCAG
CCAATGGGCACCTCGGGCACCACTTCAACAG
gtgagccactgctttctgcaggctgcacagaggcgatctctcttcactagaagtttaccc
aaacagaatctcctggtcttatgggagggcgtgtttaactccttgctttccttgtccctg
ggggatggggattgaaaagggaaattcagttaagctaattagtaactttacaccatatag

Predicted peptide sequence(s):


>PAX6_1|GENSCAN_predicted_peptide_1|817_aa
XTSVEKTLTSNSFKTPSFQTIVVFKQQQQHKKPQPNKTLDRSCDNQKGCLIKSWAGEVST
QEPKLSTSSESPRRRATAGERERRRARGGRPAQPQRQRQRQRGLSSREEGRLQARQQPRL
LAPASPNAPDPREKTKRLCGAQGPGTAAESNRCRLLCPARGPANAQRAGAPRTRRGSAEG
TCSPRLRPPAGPRALCRTGLRRRRVSRHSSAEGGTAPATSPSGVSRQGSRTLESPIFEPR
GIPRPPARASMQNNPVGSHPPSCSWWVLVRGRASLELRPGSLEAQRNQARFEVTVEAHGV
GAQLNSKCGKARVFQQPALAEPHRLKEGPQHLIHLFWKRRSPPGASGAVQWAGARLLGLG
CPMSGMAGGPVVLYLIDSRELTAEVGTGHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSG
ARPCDISRILQTHADAKVQVLDNQNVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPE
VVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQMGADGM
YDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQGLPCLGNVMGETAFEGLGHIDHIVYGCQ
QQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVF
ARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPISSSFSTSVYQP
IPQPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCML
PTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTX