GENSCAN 1.0	Date run: 14-Jan-104	Time: 23:53:10

Sequence PARVA_1 : 155645 bp : 43.52% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1293   1428  136  2  1  107   96    98 0.792  12.81
gcgagggagggagcgagggagggagcgagggaagggaaaggcgagcgtgagctgcctcaa
atgcttggaataattccgcttccgtttggaaagccgcagcctcagtcccgccgccgcccg
ctgcgtccgcccagcgccagctccgcgtcccgaccggcccgcggcagcctgcgccgcgcc
ATGGCCACCTCCCCGCAGAAGTCGCCTTCTGTCCCCAAGTCTCCCACTCCCAAGTCGCCC
CCGTCCCGCAAGAAAGATGATTCCTTCTTGGGGAAACTCGGAGGGACCCTGGCCCGGAGG
AAGAAAGCCAAGGAGG
gtgagtgcggccaggccggccgggcgggcggtaggagccgggggtgccgtaggggccgag
gggccggggcactgggaccgggcgggagcgcgccgcgggtgcccggcgcggtggggcgcg
cggcgatgcgtgcgcgcgcttcccgggtacgtcgggcaggagcgacgcgcaccccacact

 1.02 Term +   1903   1988   86  2  2   52   54   120 0.650   2.82
gcttggcggccggaggcggcgggaccggagcccaggcggggccccagcccgcagacagtg
cgatccagtaggccctgccccgccctctgcgcccgaaggctggcatttcccaagtttccg
ctgcagctttcctgggcgccgtcgctcttactcgttgccttcattggtccttaaaatcag
GTCGTTTCCTGGACCTGCTGACGTCCTCTGGCAGCGGCGTCGTGGCTTTGGCCTCTTCGG
GATCTTTTGTCCATCCCGAGGGCTGA
gaagggctctgttaatggagtaggtggacatcgagtgtttgttgaatgaatgagcgaaaa
actggcaaacctagcgtgccctcggtgtaatacacaataaactcccaccaaaggagaaaa
cctgcgtgagacacaaacttcgtcatgggcctgctgtgaactcaggcattcagggctttc

 2.06 PlyA -   2580   2575    6                               1.05
 2.05 Term -  10223  10045  179  0  2   30   47   135 0.235   1.45
 2.04 Intr -  19146  18983  164  2  2   79   22    99 0.133   2.02
 2.03 Intr -  25258  25123  136  2  1   46   88    80 0.108   3.43
 2.02 Intr -  45255  45138  118  0  1   79   70    23 0.038  -0.36
 2.01 Init -  51637  51578   60  1  0   71   65   117 0.576   6.95
 2.00 Prom -  76825  76786   40                              -1.16

 3.01 Init +  96027  96130  104  2  2   34   74   156 0.929   8.51
acactaatgatagctgatgagctattaaaaatctccagataatgtcataatgttttaaga
aagtttatgaatttgtgttgggctgcattcaaagccatcctggaccacattgcagcccgt
gagctgtgggttggacaagcttgatttaagctttgaaggtaccccttctgtgtttctgtc
ATGTTTTATGGAGAATTCTATGAAATAGTCGGTGTCTGTGAATGTGGAGATCAAGGTGGT
GACTGGCTGGTACCCTATGTGAATGTCAAAGACCTGCTGCAAAG
gtactaaataccagcctcgccatgcaagttgtgtctcttagggcgtagagagtgtttcac
tccctttgtttctcagtctccttccagtccaactgcagctatcagtgagtgtattgaggt
gaaagaactctttgtaagtggctgccttgtgcttaggatttcttgcaagtctatgctggc

 3.02 Intr +  96218  96315   98  2  2   50   73    21 0.860  -3.55
agaattctatgaaatagtcggtgtctgtgaatgtggagatcaaggtggtgactggctggt
accctatgtgaatgtcaaagacctgctgcaaaggtactaaataccagcctcgccatgcaa
gttgtgtctcttagggcgtagagagtgtttcactccctttgtttctcagtctccttccag
TCCAACTGCAGCTATCAGTGAGTGTATTGAGGTGAAAGAACTCTTTGTAAGTGGCTGCCT
TGTGCTTAGGATTTCTTGCAAGTCTATGCTGGCAATTG
gtgaggccagagtcaataaaaaaaataaaatggaaagatgggacgctgcttttattaagg
ttgattgcagctgctgtattagctctttaagaacctcttggtgaccaacgccttctgaga
aaatggcctttctgtgcttaattggcaaaaagcaaggggatttaagtcactgcttttagg

 3.03 Intr +  97390  97479   90  2  0  126   28   152 0.952  12.97
gggacaattaggtcctttcagccaggcgaggccatgaattgatcgtaggctgagtaacag
ctgtaatctacccttagtgggtttttttctcaatgtcaatatcgaacacccttgttacag
agctccaaccccctgccgtccgtcagctgaaatgtgaccctgctcttccttttcttccag
TGTCCGAGCTGCAGGAGGAGGGAATGAACGCCATCAACCTGCCCCTCAGCCCAATTCCCT
TTGAGCTGGACCCCGAGGACACGATGCTGG
gtaactgtgctcttgtctctgaattcgcttaagctttcccatgccagcacccccactgaa
ttccttttctttttaaagaggagaatgaggtgcgaacaatggtggatccaaactcacgca
gtgaccccaagcttcaagaactgatgaaggtaagaagaaatcaggagcggcttcaggtgc

 3.04 Intr +  97558  97628   71  2  2   71  116    64 0.942   6.40
cttttcttccagtgtccgagctgcaggaggagggaatgaacgccatcaacctgcccctca
gcccaattccctttgagctggaccccgaggacacgatgctgggtaactgtgctcttgtct
ctgaattcgcttaagctttcccatgccagcacccccactgaattccttttctttttaaag
AGGAGAATGAGGTGCGAACAATGGTGGATCCAAACTCACGCAGTGACCCCAAGCTTCAAG
AACTGATGAAG
gtaagaagaaatcaggagcggcttcaggtgcctcactgacccaccatgtgtccatatgcc
acctgctctgtgcaggtaccccacgagcccctgagagaaggtaaaaagtcatggcagccc
ctgcctcaggcagtgagttgtctagcagatggccatcgaaaacgtaaccgattgtttaag

 3.05 Intr + 101492 101594  103  1  1  120   66    90 0.885   9.75
gagcccaggagtttaagtccagcctaggcaacatagtgagaccccatctcaaataaaatg
aaacttaaaatctaaagttaatttggattttaattgtttaggataagaaagctggtctgt
aagaaaataccccataactcttttcttactattgcacattccctttctctctctctgtag
GTATTAATTGACTGGATTAATGATGTGTTGGTTGGAGAAAGAATCATTGTGAAAGACCTA
GCTGAAGATTTGTATGATGGACAAGTCCTGCAGAAGCTTTTCG
gtaggagagttgagtgctgcaatggatgtgtgtttaattgcaggtggttggatcacctac
ttgtagctagaaggagttattctcagtttacagtggcttacctggaaatggattacaaat
gtgtggagcatggaataacagctcagtgaaggctttagatgtcctcttggaatgtttcat

 3.06 Intr + 120103 120243  141  2  0   95   68   155 0.987  14.52
ccaccataaggtgatgaggggacagcagtgtccctctgctggtaggcatccagtatctat
tgttgcaagagtgcatgcatgcatgagtgcatgagagaccgaataactgagtaagtgcat
gcagtagggttgtctggggcccagcataacagctgttctcttttcccttgtcaccctcag
AGAAACTGGAGAGTGAGAAGCTAAATGTGGCTGAGGTCACCCAGTCAGAGATTGCTCAGA
AGCAAAAACTGCAGACTGTCCTGGAGAAGATCAATGAAACCCTGAAACTTCCTCCCAGGA
GCATCAAGTGGAATGTGGATT
gtgagttgaacaaaggaaaggggcaccattaaacaatgcctgtggtccctgccatggggc
ttccccaagaagccatccataagcttggcaggcttcaggggagggggtcaaactcattta
tctttgaacaagttgccccgcttcctcagaacttggaagaagttccatccatacccttgg

 3.07 Intr + 127959 128074  116  1  2   95  110    79 0.888  10.97
tccaaatacctcccaccaggccccacctccaacaccggggattacatttcagcatgagat
ttgggcagggacaaatatccaaactctatcagtggggtactactacactttgaacatctg
cttatattgcctagaacctggaagaagatgctgtaatttttcaatcttctttcatttcag
CTGTTCATGCCAAGAGCCTGGTGGCCATCTTACACCTGCTCGTTGCTCTGTCTCAGTATT
TCCGCGCACCAATTCGACTCCCAGACCATGTTTCCATCCAAGTGGTTGTGGTCCAG
gtaagacaggtaacactacaaacatctgtgtctttaaagagtcgtggaggtcgagttcct
atggtgcgtcgagtaggtcattagaaggatggctgcatgaatgttgagtgagcctgggtg
tgcagtatattgggaggcactgaatgagctttctgttgcatgttggcttcccctggtaag

 3.08 Intr + 132229 132277   49  0  1  105   52    37 0.087   0.05
gttcagtccagtccctgaaaatcaggacctcctttcacttccagcattatcttatcttgg
gtgcatttcttaaacaccagtaactttctcattatcaggaatgctcatcagtgtttctgt
atttttctaaagcatagttttctcttctcctcccaacccctttccccacccccatttcag
AAACGAGAAGGAATCCTCCAGTCTCGGCAAATCCAAGAGGAAATAACTG
gtaacacagagtatgtcaacaccattgttgccagcgattctgtaatggaacacagatgtt
tctctgaaattcatccatttgctgatatttagttttcatttattgggattgcaggaggga
ttagacttcagccaatgattatagtttagccttttccatgcattcaaaacatgcctctca

 3.09 Intr + 136944 137005   62  1  2  119   81    94 0.933  10.25
tcaccccaaatcttagccccaaatcacattccagagttcccggcacagtctataccccag
aggcttcccatcggtagttgaccttgtgaccttgagaggcgcgtggctctgggacccaag
gtgggcttccctgccagggatcagctcttgtgctccacattgtgtttccctctttttcag
AACGTGATGCCTTTGACACCTTGTTCGACCATGCCCCAGACAAGCTGAATGTGGTGAAAA
AG
gtgggaaaggggtgcctgggatggacagagggaagcgagatgcaacagaacattgggaaa
acccatccctgcagcttgcgagcttcctgccagaactggtggcatcacctaacctctgca
cacacagggctttcccccttgccatccatgtacctgtctgttcctcactggatgttgcac

 3.10 Intr + 137642 137710   69  1  0   89   94    94 0.995   9.48
gtggccctccctgtgcactcaatggcctttgcagagagagctcctgggcccagggctctt
ggctgggcctgatcctctgctttcaccctcacccttgccctcacgggagtcacggagcag
ccacaggctcctgcactagtgcgagtccccagcttagggcctgctttgcttctcttttag
ACACTCATCACTTTCGTGAACAAGCACCTGAATAAACTGAACCTGGAGGTCACAGAACTG
GAAACCCAG
gtgggtgacagaccccagcacaggtagaggcagggccctgccctacagcccctgttccaa
gtggcccaccacacttggccaggagggctttcccagctgagggggatgagggcatgggaa
tctgtcctactctgaggggtggactgagtctctgtggattttttccaactttttattatg

 3.11 Intr + 141255 141356  102  2  0   72  116   155 0.673  17.07
ccagccagacgtggggcagagcagacctccttgtctcgggccactgcccctacccccgag
ctagcagcctggctggggtggtaggcttcaggtggcatagcacagaagttgatgggcccc
ctggatggggattggctgggaggctcaggggccagtgccatcacctggctcttcctccag
TTTGCAGATGGGGTGTACCTGGTGCTGCTCATGGGGCTCCTGGAGGGCTACTTTGTGCCC
CTGCACAGCTTCTTCCTGACCCCGGACAGCTTTGAACAGAAG
gtaaggagaagggacatcaagggaggccccctagcccacatcccctgactcatgtgccca
cacccatgctggggctatccagaaaaaaggcagaagcttcccctctgctcaacgtcttca
gtgcctggaggtgggacccattataagagctgagctgggaaggagctacctgcagaccac

 3.12 Intr + 142090 142162   73  0  1   86   75    49 0.796   2.38
gctaggatcagctagctcacgctccaggtggcctgcccattttggtagccatatttctcc
ttgaaattagttcagcctctgtccctctggctacagtgctgggctccttcacttcccagg
gccaggtcctggggctcctgggtgtgcaatggtacatgctgtctgcatctctcttgccag
GTCTTGAATGTCTCCTTTGCCTTTGAGCTCATGCAAGATGGAGGGTTGGAAAAGCCAAAA
CCGCGGCCAGAAG
gtactttgctctttcctgggtttgtgacaacagagtgagaccctctccctgcacatgagt
actcagattttgtagcagagggaagcattttctgaagccttcgttgctggggaaggtggg
actcggtgcagctgctcagtcccagagaccctttgtgagctgccagctgcacagccaggg

 3.13 Term + 151494 151570   77  1  2   76   55   144 0.943   7.90
ccccagcacctctaccctcactgccccctgctctgaattctcgctgcccactctacccat
ctgccccgaacatgctgggtacatgggattgggtggtgggtggaagggaggggcagtgta
tgccagctttggaacatgtggccccatggaaacaattggtgttttttgttttctacgcag
ACATAGTCAACTGTGACCTGAAATCTACACTACGAGTGTTGTACAACCTCTTCACCAAGT
ACCGTAACGTGGAGTGA
ggggctgccctgggcccaccactgcccaagagttcttgctgttggcgtactggaccctcc
tccgaactgccttaccctgcttattcctgtctcttgcactgtgctctcccacaagtccag
ctgcaacccagagatagtggaaactgaaattaggaaggaaatcatcaataactcagtggg

Predicted peptide sequence(s):


>PARVA_1|GENSCAN_predicted_peptide_1|73_aa
MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEGRFLDLLTSSGSGVV
ALASSGSFVHPEG

>PARVA_1|GENSCAN_predicted_peptide_2|218_aa
MGMQWAMSAALQVLLPFSALSTAWTAVIPPCGQLTEAPLAILRPCEVHFSKTVLCNHFKD
NSILQYDVFNFVRFMTKVNINATDTGLAPACSIVCVCCRMVLCKRKPVLLTFRGSGAHLQ
QPDSPGTDHYLQEYLRIRVQKLTNGSQTEPLKTCVKLFFGKRAVTIVCDKQLQCNMTSAS
TEYRQGTVGSQRRKHLTLPVGTVEGFMQKRTSELGLYE

>PARVA_1|GENSCAN_predicted_peptide_3|384_aa
MFYGEFYEIVGVCECGDQGGDWLVPYVNVKDLLQSPTAAISECIEVKELFVSGCLVLRIS
CKSMLAIVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELM
KVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQ
TVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVV
QKREGILQSRQIQEEITERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELET
QFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPED
IVNCDLKSTLRVLYNLFTKYRNVE