GENSCAN 1.0	Date run: 15-Jan-104	Time: 01:59:40

Sequence P2RY2_1 : 20449 bp : 55.26% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    113    345  233  1  2   90   13   150 0.579   3.43
ccctggaaggtgcgtggcccagcttagacaataggcgcaggaggctagacaaggggcctt
tgtgtctcccaagcaaaggccccagcaggactgcagaggcggctcagccactATGGGCTGTGTGTCCACTCTGCTACTGCTCCTGGTGGGGCTGCAGCCAGCACCCTTCCTG
GCAGCCAGGCCCAGTCAGCTGATATGGAGCCCAAGAGGGCCCAAGGCCCCGAAGGCCCGG
GGCAAGTTCCTTGGCTACAGGAAGAGGCCTCCTCTGCACTTGTCCAGCCAGCGGAGCGAT
TGGCTCCATTTCACAGGAAAGAAGACCCTGCCAGGGAATGGAACTGGGTCAAG
gtctcccagagtcagtgctgaagccagacaggaacctacactcctgattcctagaccaga
aatgagagagaggcggggtgctcattcattcatccattcacaccttcaaggattgagcac
ctcccaggacctctaggacagcagcaggaagaaggcagacctggttcctgccctcgggag

 1.02 Intr +   5116   5153   38  1  2  125  105     6 0.938   4.39
tagcgggagtttctggtaggagggtgagcagcctgggccccgtggaacaactccttgacc
ctctgccctggtaccttgtcactgtcattgtagctcctgaatgagaggcctgggtgctgg
agtgagggaaagggacctccctcagacttctggggctttatgtggcctctccctccccag
GTCTGAGGAGAGCCTCTGGGTGTCGACCTGGCTTCCTG
gtgagtgcccagccacccagccctggcttgtaggagggggactcttgccatggctgggct
gttgcaggaaatccagggccaagggacctgctcctctcatggcaccaccgtatgtgtcgt
ctcctccttggtctccctccctccagactccctgtcccatctaccttccatgtggcacca

 1.03 Intr +   5944   6084  141  2  0   27   67   146 0.743   7.23
catgtctgtgtctttttcctcagcctgactgggtactcctcaagggcccagcagagtgca
atctgagtctgagttcacaaggtccatctgaggccaggtgcaccagagcattggcaagtg
tttgctgggactttgtggttcctgggaatgtgatttaagatttcattactctgaatccag
ACCCCTGTGGCTCTGAGAATCTCAAAACCAAAGGCTATCAGGAGCAACGAGTAATAGAAT
TGAAGAAACACAGCCTTCACACCCGGAACCAGAGCCTCTTGGAATTAGACTGCGAGAACC
AGGGAACTCAGAATCCTGGAG
gtacctggaggggccatctcagaatcagaggctcatgtggttcctggttgatgctttcat
ccccctttccaccttggattctccatccaccttctttcctcccaagctggacccttcctg
ctcctcctcaaatcttatcacagttccccttccagggaccttgcctgactgctctgacca

 1.04 Intr +  11957  12083  127  0  1   65   16    91 0.123  -0.16
agtggaagtggctgcaggaggtaggtagtgaactccctgtttatgggagtgtgcagaggc
tgcagagggcttgtgcctgtgtgtgcctcctctgggcccccatagcctcttgtgcttgct
tcattcattcattcattcattcattcattctctcattcctgtaatacctcctgtggtcag
GCCTCCTGCTGGATGATAGGGACAGAGAAAAGCATCAGATGGACCCAGCCCTCAAGGAGC
ACCTGAAATGTGTTGGGGTAGAGGATGGAAGGACAAATTACCAACTGGCTGAGAAACGTC
CTGAGGG
gtgatggaagggagaacttcagagattagaagatcctttgggacctacaatggggtgcag
tgtgggtgggttcggggaaggctttccagtgagaaagaacagcatgaacacaggcagggg
agcctggaagggtcttacaaggctcacatctcccctccagactgggagctccttggggca

 1.05 Term +  17058  18195 1138  0  1  133   49  1916 0.240 184.18
attgtgtgatcctgatatttattcattgatctcatgcattctcaaggttccagagcttgg
aggttccaggtccagatccaagtcagatggcaatgaaagccctggtcaggtggctgtgtc
aggtcccctaggggcgctccggccacaaccctgatggccccacccctcccttccctgcag
GGCGATGGCAGCAGACCTGGGCCCCTGGAATGACACCATCAATGGCACCTGGGATGGGGA
TGAGCTGGGCTACAGGTGCCGCTTCAACGAGGACTTCAAGTACGTGCTGCTGCCTGTGTC
CTACGGCGTGGTGTGCGTGCCTGGGCTGTGTCTGAACGCCGTGGCGCTCTACATCTTCTT
GTGCCGCCTCAAGACCTGGAATGCGTCCACCACATATATGTTCCACCTGGCTGTGTCTGA
TGCACTGTATGCGGCCTCCCTGCCGCTGCTGGTCTATTACTACGCCCGCGGCGACCACTG
GCCCTTCAGCACGGTGCTCTGCAAGCTGGTGCGCTTCCTCTTCTACACCAACCTTTACTG
CAGCATCCTCTTCCTCACCTGCATCAGCGTGCACCGGTGTCTGGGCGTCTTACGACCTCT
GCGCTCCCTGCGCTGGGGCCGGGCCCGCTACGCTCGCCGGGTGGCCGGGGCCGTGTGGGT
GTTGGTGCTGGCCTGCCAGGCCCCCGTGCTCTACTTTGTCACCACCAGCGCGCGCGGGGG
CCGCGTAACCTGCCACGACACCTCGGCACCCGAGCTCTTCAGCCGCTTCGTGGCCTACAG
CTCAGTCATGCTGGGCCTGCTCTTCGCGGTGCCCTTTGCCGTCATCCTTGTCTGTTACGT
GCTCATGGCTCGGCGACTGCTAAAGCCAGCCTACGGGACCTCGGGCGGCCTGCCTAGGGC
CAAGCGCAAGTCCGTGCGCACCATCGCCGTGGTGCTGGCTGTCTTCGCCCTCTGCTTCCT
GCCATTCCACGTCACCCGCACCCTCTACTACTCCTTCCGCTCGCTGGACCTCAGCTGCCA
CACCCTCAACGCCATCAACATGGCCTACAAGGTTACCCGGCCGCTGGCCAGTGCTAACAG
TTGCCTTGACCCCGTGCTCTACTTCCTGGCTGGGCAGAGGCTCGTACGCTTTGCCCGAGA
TGCCAAGCCACCCACTGGCCCCAGCCCTGCCACCCCGGCTCGCCGCAGGCTGGGCCTGCG
CAGATCCGACAGAACTGACATGCAGAGGATAGAAGATGTGTTGGGCAGCAGTGAGGACTC
TAGGCGGACAGAGTCCACGCCGGCTGGTAGCGAGAACACTAAGGACATTCGGCTGTAG
gagcagaacacttcagcctgtgcaggtttatattgggaagctgtagaggaccaggacttg
tgcagacgccacagtctccccagatatggaccatcagtgactcatgctggatgaccccat
gctccgtcatttgacaggggctcaggatattcactctgtggtccagagtcaactgttccc

Predicted peptide sequence(s):


>P2RY2_1|GENSCAN_predicted_peptide_1|558_aa
MGCVSTLLLLLVGLQPAPFLAARPSQLIWSPRGPKAPKARGKFLGYRKRPPLHLSSQRSD
WLHFTGKKTLPGNGTGSRSEESLWVSTWLPDPCGSENLKTKGYQEQRVIELKKHSLHTRN
QSLLELDCENQGTQNPGGLLLDDRDREKHQMDPALKEHLKCVGVEDGRTNYQLAEKRPEG
AMAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFL
CRLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYC
SILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGG
RVTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRA
KRKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANS
CLDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDS
RRTESTPAGSENTKDIRL