GENSCAN 1.0	Date run: 15-Jan-104	Time: 01:54:14

Sequence MYEOV_1 : 5522 bp : 57.86% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.05 Intr -   1423   1394   30  2  0   85   84    54 0.675   3.93
 1.04 Intr -   1676   1499  178  2  1  126   65    30 0.471   5.19
 1.03 Intr -   3028   2419  610  0  1   71   25   264 0.238  12.24
 1.02 Intr -   3170   3104   67  0  1   71   99    44 0.620   2.91
 1.01 Intr -   3291   3234   58  0  1  101   49    33 0.271   0.30

Predicted peptide sequence(s):


>MYEOV_1|GENSCAN_predicted_peptide_1|315_aa
GLNSHNSQPGPSHPQRQAPVRAARFCQGHAECPGTGQKSSPRARANGLLNAHSKGFSQVS
NAHHPCRLTPRIPVPSATQSALWCICDPPGPGHVHVFCLLAEPRTCLGTLVSLVSLPVTS
SSSKPQRHKCSSHRNTQGLGETEAAPGSAGFGALHEVSSLPGEHEQRVPVPKGDRLQTRK
PMNKSDISRWHSPTQEKRLLGSGKCRHLVEVEGQEGHTTETMTPGGRLFQAEATASAETY
RESWGLVPHPAATGLSLKHKKDPASYLLRSHQEPATSLQINSRLFTEPKGNEQKCPEITQ
SSAGGVTAEASTTGX