GENSCAN 1.0	Date run: 14-Jan-104	Time: 23:39:48

Sequence MMP26_1 : 6633 bp : 38.88% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1219   1351  133  0  1   48   15   132 0.099   2.25
gtcacccttgcatgctggtcactctgccctcagcaggtatggatgatgacgccactcaca
gattcaaagaaagggcaaactggcagagtgagtcattggatgttgctggcacagctataa
agatccagtggcccaagttgtgtacctgaattcaagcagtgggacaaatgagggtttggc
ATGCAGCTCGTCATCTTAAGAGTTACTATCTTCTTGCCCTGGTGTTTCGCCGTTCCAGTG
CCCCCTGCTGCAGACCATAAAGGATGGGACTTTGTTGAGGTAGGTGAACGACTCAGGACC
ACATTATTACATG
gtgaccattgtgggctcttatttcgtgtgtgtgtgtatgtgtgactgcatggtataatga
taaatacacacattaatattacacatgaaaacattttattctatctatgtgttcattttt
ctcttctaattttaagaaaaaaattaattttttgtagcccctaaaagtgtttttgggccc

 1.02 Intr +   4378   4503  126  2  0  107   59   100 0.688   8.73
agagtaggaagattttgggccccaccttatttctctgcatagataatgccttagctctct
cacatcccccagtggtagactgttgcacagtatcctaagtctctgaggcttacttaagac
tattctggcctttgtttctacctccaccctcattgtgatcatagcttctgtcgtccacag
CCCATGAAGATGGTTGGCCCTTTGATGGGCCAGGTGGTATCTTAGGCCATGCCTTTTTAC
CAAATTCTGGAAATCCTGGAGTTGTCCATTTTGACAAGAATGAACACTGGTCAGCTTCAG
ACACTG
gtaaatgccttgtttggtgggatcgctagaactctctgggaacctggggttcagtgttga
tggtttccatttagggatccagagtggtcagggtgaggtggaagatttggctgaggaatc
aggtcttctttataagtgaggagatgtgggatcatttctgaacacagatgatcccataat

 1.03 Intr +   4971   5132  162  1  0   92   26    96 0.252   2.83
atcttgccattctgttttctacttactttctttccctccttgcctaccttttcctttacc
ctgtaacatttgccctttcctcgttttctgttctctcctttttctttgtcctatttcaca
cactttcagcattccctatgcatagttaattttatcttttttttttctataatttttcag
GATATAATCTGTTCCTGGTTGCAACTCATGAGATTGGGCATTCTTTGGGCCTGCAGCACT
CTGGGAATCAGAGCTCCATAATGTACCCCACTTACTGGTATCACGACCCTAGAACCTTCC
AGCTCAGTGCCGATGATATCCAAAGGATCCAGCATTTGTATG
gtctgtgctgcttaaggaagagaagggagatctgggcaggaaaatttcacctgaaattta
ctgttgttttttttttctgtttccataggagaaaaatgttcatctgacataccttaatgt
tagcacagaggacttattcaacctgtcctttcagggagtttattggaggatcaaagaact

Predicted peptide sequence(s):


>MMP26_1|GENSCAN_predicted_peptide_1|141_aa
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEVGERLRTTLLHAHEDGWPFDGPGGILG
HAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWY
HDPRTFQLSADDIQRIQHLYX