GENSCAN 1.0	Date run: 15-Jan-104	Time: 02:05:09

Sequence MGAT2_1 : 13910 bp : 51.83% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1270   1360   91  0  1   88  106    58 0.927   8.36
tgtaggatagaatttcctgcctcagcaggggcaaggaggccttggggctgggctgggctg
ggctgggtgtggcactctccctgccagcttctacaacctggggagggaacaaaaacctgt
gggtgcctcagaccacagcagagctcacagaacctgcgggagccaggctgacccgccagc
ATGGTAGAGTTCGCGCCCTTGTTTATGCCGTGGGAGCGCAGGCTGCAGACACTTGCTGTC
CTACAGTTTGTCTTCTCCTTCTTGGCACTGG
gtaagttgggctgcactgtaagacgggagaccaccgcactcaggtggggcagagcagcca
caccaggtgcacacagcacattgatggtggcaagacatttatcctaaagggggctttgtt
gcgctcagagcccctgcccagagagaactcctgggcctgcccagaggcttcttgggggtg

 1.02 Intr +   3373   3551  179  2  2  128  109   136 0.957  19.86
cctctcagggactttgtctcctctttgaatgccccggaagctgctgtcttcctcctgggc
ccgaggattggacaggacagtgctgctagtgccaggcctatgggcagagttcagtctgag
caatctcacctgccttcctctcagacccctgtccctgacagctccttcttccctccccag
CCGAGATCTGCACTGTGGGCTTCATAGCCCTCCTGTTTACAAGATTCTGGCTCCTCACTG
TCCTGTATGCGGCCTGGTGGTATCTGGACCGAGACAAGCCACGGCAGGGGGGCCGGCACA
TCCAGGCCATCAGGTGCTGGACTATATGGAAGTACATGAAGGACTATTTCCCCATCTCG
gtgagtattgaggctggttggggttggggagggagttggctggggtgtggtcagggccag
agtgccgacgtctccatgggagaatatggccctgcatgcactgaggagggtactgggctg
ggaggcaggagctagggcttccgctactatgtgacctagagaagagtccagcttctctcc

 1.03 Intr +  10816  11020  205  0  1   70  109   183 0.886  17.90
atatctccaggtgctgtcacataccatatctgaatcttcgtaagaacccagggtggtcag
acatatggatgaagacctggaggctcagaggggaggtttcccaaggtcacaccagtgagt
ggcagagtcagggctggtacacaggccccgccctggctcagcaggttgccgtccctgcag
CTGGTCAAGACTGCTGAGCTGGACCCCTCTCGGAACTACATTGCGGGCTTCCACCCCCAT
GGAGTCCTGGCAGTCGGAGCCTTTGCCAACCTGTGCACTGAGAGCACAGGCTTCTCTTCG
ATCTTCCCCGGTATCCGCCCCCATCTGATGATGCTGACCTTGTGGTTCCGGGCCCCCTTC
TTCAGAGATTACATCATGTCTGCAG
gtgagtctttctacccctgagcagctcaggaaggtaacaaattttcggaagggttgccaa
tagttctgtacttcttccaagagcgtgtgcagtaggagaaggaggctaggcccaaagaag
cacttcctacagcaccatgctgggcgctgagtccatcagggggttgggaagagggagaag

 1.04 Intr +  11351  11525  175  0  1  147   36   151 0.999  15.31
gtccatcagggggttgggaagagggagaagactcagggagctcctagctggaatggggtg
cagtgggggaaaaaccccaggcctcagtaggcattgctggtgatctctttatgggctaca
tgtactttcatagcccctgctccctcaccccatacctgacccacttttctctttccctag
GGTTGGTCACATCAGAAAAGGAGAGTGCTGCTCACATTCTGAACAGGAAGGGTGGCGGAA
ACTTGCTGGGCATCATTGTAGGGGGTGCCCAGGAGGCCCTGGATGCCAGGCCTGGATCCT
TCACGCTGTTACTGCGGAACCGAAAGGGCTTCGTCAGGCTCGCCCTGACACACGG
gtatcaagcctctgggaagagcactctgggttcagttggcaattggcaaggattttattt
tggtgggaagatggcagagacgaatgcagattctattttggtagagattttcagtccatt
cacaattaagattatattttggtgtcttatgcccaaatacctagaaaagtttccacaacg

 1.05 Intr +  12171  12370  200  0  2  138  106   240 0.995  30.32
aaggtcagagaatggggctgtgaaggtctgggagataacccaggcctccacctccagccc
aggtggctgacctctgctccatttcttggtcactgagtccctgcaggaagctaaagggcc
tttcagctcgtgccttctctggggcctcccacatgccctctttcctctatttgtctccag
GGCACCCCTGGTGCCAATCTTCTCCTTCGGGGAGAATGACCTATTTGACCAGATTCCCAA
CTCTTCTGGCTCCTGGTTACGCTATATCCAGAATCGGTTGCAGAAGATCATGGGCATCTC
CCTCCCACTCTTTCATGGCCGTGGTGTCTTCCAGTACAGCTTTGGTTTAATACCCTACCG
CCGGCCCATCACCACTGTGG
gtaagtccaggaccaggctgggagggaggaggccaaagggacagggcaggttgtgtgctg
caaggggacatggagatgagccagatttattcctgccctaatggggctcacattctagac
tgggaaacatacacacacaagcagatagaatagaagacagtctgggataggaactatagc

Predicted peptide sequence(s):


>MGAT2_1|GENSCAN_predicted_peptide_1|284_aa
MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLD
RDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFAN
LCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNL
LGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSG
SWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVX