GENSCAN 1.0	Date run: 15-Jan-104	Time: 02:17:41

Sequence IRF7_1 : 5494 bp : 63.58% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1287   1506  220  1  1   38   94    70 0.267   1.18
cggggtgggatcgaggagggtgcgaagcgccactgtttaggtttcgctttcccgggagcc
tgacccgcccctgacgtcgcctttcccgtctccgcagggtccggcctgcgccttcccgcc
aggcctggacactggttcaacacctgtgacttcatgtgtgcgcgccggccacacctgcag
TCACACCTGTAGCCCCCTCTGCCAAGAGATCCATACCGAGGCAGCGTCGGTGGCTACAAG
CCCTCAGTCCACACCTGTGGACACCTGTGACACCTGGCCACACGACCTGTGGCCGCGGCC
TGGCGTCTGCTGCGACAGGAGCCCTTACCTCCCCTGTTATAACACCTGACCGCCACCTAA
CTGCCCCTGCAGAAGGAGCAATGGCCTTGGCTCCTGAGAG
gtaagagcccggcccaccctctccagatgccagtccccgagcgccctgcagccggccctg
actctccgcggccgggcacccgcagggcagccccacgcgtgctgttcggagagtggctcc
ttggagagatcagcagcggctgctatgaggggctgcagtggctggacgaggcccgcacct

 1.02 Intr +   1592   1754  163  2  1   89   81   282 0.967  28.77
tctgctgcgacaggagcccttacctcccctgttataacacctgaccgccacctaactgcc
cctgcagaaggagcaatggccttggctcctgagaggtaagagcccggcccaccctctcca
gatgccagtccccgagcgccctgcagccggccctgactctccgcggccgggcacccgcag
GGCAGCCCCACGCGTGCTGTTCGGAGAGTGGCTCCTTGGAGAGATCAGCAGCGGCTGCTA
TGAGGGGCTGCAGTGGCTGGACGAGGCCCGCACCTGTTTCCGCGTGCCCTGGAAGCACTT
CGCGCGCAAGGACCTGAGCGAGGCCGACGCGCGCATCTTCAAG
gtggggaccccagccccgccccgccccgggtgggagagcccgcctaggaccccgcgggcc
cggcacacgtgttctgtccccctcttcaggcctgggctgtggcccgcggcaggtggccgc
ctagcagcaggggaggtggcccgccccccgaggctgagactgcggagcgcgccggctgga

 1.03 Intr +   1844   2054  211  1  1  111   83   256 0.999  27.10
gtggctggacgaggcccgcacctgtttccgcgtgccctggaagcacttcgcgcgcaagga
cctgagcgaggccgacgcgcgcatcttcaaggtggggaccccagccccgccccgccccgg
gtgggagagcccgcctaggaccccgcgggcccggcacacgtgttctgtccccctcttcag
GCCTGGGCTGTGGCCCGCGGCAGGTGGCCGCCTAGCAGCAGGGGAGGTGGCCCGCCCCCC
GAGGCTGAGACTGCGGAGCGCGCCGGCTGGAAAACCAACTTCCGCTGCGCACTGCGCAGC
ACGCGTCGCTTCGTGATGCTGCGAGATAACTCGGGGGACCCGGCCGACCCGCACAAGGTG
TACGCGCTCAGCCGGGAGCTGTGCTGGCGAG
gtgagcgacgccggctgccaagggcgttggcattcgtcctgcttgggcaaaggggaacat
tctctgggtcagatttgtggttttagaagctgttctgggagaggctgccagcaggcccag
gacaggtggagagccacatccccacctcctcaggccacagcctaagggttcacagccagg

 1.04 Intr +   2814   2900   87  1  0  110   94    27 0.934   6.60
agagggacaagaagggcttcccctgactggggcctgtgctggaggtgtgggcgtgcccgg
ggagggggggagcgcgggaggggccagtgcacctggacggacactttagaagggggctgg
ggattggggagctggagaattaggaggggaccaccgttcccactgtcctcccctcctcag
GCCCAGGGCTCCCTGCTGGGGAGCTGTACGGGTGGGCAGTAGAGACGACCCCCAGCCCCG
GGCCCCAGCCCGCGGCACTAACGACAG
gtgagaggggtaggggttgggaggcctggggcacagggagaggctagggatgaggtgcca
gcacaggattcccttccggatgcaggcgaggccgcggccccagagtccccgcaccaggca
gagccgtacctgtcaccctccccaagcgcctgcaccgcggtgcaaggtgagtgcatccca

 1.05 Intr +   3256   3645  390  2  0   75   86   560 0.817  50.51
tcccaggaaggggcagcctgtccccgcccacccccgtcactcacggcttgtccccgccca
cccatcactcacatcctgtccccgcccacccccgtcactcacatcctgtccccgcccacc
cccgtcactcacagcctgtccccgcccacccccgtcactcacagcttggtctccacacag
AGCCCAGCCCAGGGGCGCTGGACGTGACCATCATGTACAAGGGCCGCACGGTGCTGCAGA
AGGTGGTGGGACACCCGAGCTGCACGTTCCTATACGGCCCCCCAGACCCAGCTGTCCGGG
CCACAGACCCCCAGCAGGTAGCATTCCCCAGCCCTGCCGAGCTCCCGGACCAGAAGCAGC
TGCGCTACACGGAGGAACTGCTGCGGCACGTGGCCCCTGGGTTGCACCTGGAGCTTCGGG
GGCCACAGCTGTGGGCCCGGCGCATGGGCAAGTGCAAGGTGTACTGGGAGGTGGGCGGAC
CCCCAGGCTCCGCCAGCCCCTCCACCCCAGCCTGCCTGCTGCCTCGGAACTGTGACACCC
CCATCTTCGACTTCAGAGTCTTCTTCCAAG
gtcagtgaggcccttgcctggggggctgtctccaggggtccttgggagcacctgcctgcc
aggtactcagcagagtccccttcttcagagctggtggaattccgggcacggcagcgccgt
ggctccccacgctataccatctacctgggcttcgggcaggacctgtcagctgggaggccc

 1.06 Intr +   3734   3852  119  0  2   23  100   148 0.794  10.86
acccccaggctccgccagcccctccaccccagcctgcctgctgcctcggaactgtgacac
ccccatcttcgacttcagagtcttcttccaaggtcagtgaggcccttgcctggggggctg
tctccaggggtccttgggagcacctgcctgccaggtactcagcagagtccccttcttcag
AGCTGGTGGAATTCCGGGCACGGCAGCGCCGTGGCTCCCCACGCTATACCATCTACCTGG
GCTTCGGGCAGGACCTGTCAGCTGGGAGGCCCAAGGAGAAGAGCCTGGTCCTGGTGAAG
gtgagaccagagcctcaaggaggggaggccatgtgctcaggcccactgacagacgcctga
tgccctcagagcctcggagagggggaggggaggccatacaccgggtcactgacagacgcc
cgacgccctcagagcctggggagggggaggggaggacacacgccgggtcactgacagacg

 1.07 Term +   4051   4206  156  0  0   55   42   184 0.939   9.38
ggaggggaggccatgtgctcaggcccactgacagacgcctgatgccctcagagcctcgga
gagggggaggggaggccatacaccgggtcactgacagacgcccgacgccctcagagcctg
gggagggggaggggaggacacacgccgggtcactgacagacgcccgatccctcctggcag
CTGGAACCCTGGCTGTGCCGAGTGCACCTAGAGGGCACGCAGCGTGAGGGTGTGTCTTCC
CTGGATAGCAGCAGCCTCAGCCTCTGCCTGTCCAGCGCCAACAGCCTCTATGACGACATC
GAGTGCTTCCTTATGGAGCTGGAGCAGCCCGCCTAG
aacccagtctaatgagaactccagaaagctggagcagcccacctagagctggccgcggcc
gcccagtctaataaaaagaactccagaacacgtactggcatcttggctggtggggaattg
ggtccaggctgaacacgggtgaggcccagggagggaggggacctccacggcctccctgca

 2.02 PlyA -   4611   4606    6                              -3.24
 2.01 Term -   5217   5074  144  0  0   54   54   260 0.983  18.05

Predicted peptide sequence(s):


>IRF7_1|GENSCAN_predicted_peptide_1|448_aa
XTPVAPSAKRSIPRQRRWLQALSPHLWTPVTPGHTTCGRGLASAATGALTSPVITPDRHL
TAPAEGAMALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLS
EADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSG
DPADPHKVYALSRELCWRGPGLPAGELYGWAVETTPSPGPQPAALTTEPSPGALDVTIMY
KGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAP
GLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELV
EFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDS
SSLSLCLSSANSLYDDIECFLMELEQPA

>IRF7_1|GENSCAN_predicted_peptide_2|47_aa
ICHSKSGEINPVKVANLVKAYVDKYRHMRRHKKPEAGEEPPTQGAEG