GENSCAN 1.0	Date run: 15-Jan-104	Time: 00:05:00

Sequence GAS2_1 : 147292 bp : 35.74% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1451   1526   76  1  1   60   65    88 0.483   5.00
ctgattaactgcagctggggtctgatttgcccagcctgtctttgatattgatcaatgaac
tccttctcaaggaatgctttcctctaactgcggtgaaggtggtggctctggtggttctct
ccaacatgggtgtctgggttttgactgcctaagagaaggtaagggacagatggatgaggc
ATGGGACAGTGTGCCTTTGCAAAGCACATTGGAGACTTTGCACAGGGCTGCCTGAATGGT
CCCTTACATGGAAAAG
gtagcttggatttcagcctgaatgctactgaagtttgggtttatttcattactttattgc
taaacactatgctgtggtgttatggactgtgctttactgggaaataagttcacatggcaa
aaaaatatttcaccaggtgcaaaaggtcatgtgattgccctggaattttttagcatcttg

 1.02 Intr +  18761  18882  122  0  2  104   93   135 0.573  14.89
tcttgcaaccaaaggaagatagaaaattccaaagaaatgactatttctggtaagctccta
tcccagttatgtaactcagctagaatagcaattttagtgataaaactgtgtcaaatattt
tatttagtgtgaatctgacatttgattttccttttataatgcttctttttgttatttcag
GGAAGGAGATTACAGCAGAAACTTTTATGGAGAAGTTGGACAATGGTGCCTTGCTCTGTC
AACTTGCAGAAACTATGCAGGAGAAATTCAAGGAGAGCATGGATGCTAACAAGCCCACAA
AG
gtaaaagatcccaatgcaaaaatcactcttaggtggtagattacatttataattgcttat
aaattgtgtgtaattaaaaaatttattgtgaacggatgcatcaaggtctatactaacaac
aaagtacagagagttctttttaattaggtaacatgttatttgcactctaattacataaat

 1.03 Term +  21985  22221  237  0  0   -1   53   149 0.330  -2.32
ctgaatataaagctaaatttttttctgattgtgataaaggttttagtataaaaccttaaa
tgtgttacttgaacaagtggaggtttaaaaatacttattatcatctcaccaaaaagtcac
atgcacctgtatgttcatagcagcactattcactactgcaaagacatgaaatcaacctag
ATACTCATCAACGGTGGACTGGCTAAGAAAATATGGTCCCTATATACCATGGAATACCTT
GCAGCCATAAGAAACCAAAATCATGTCCTTTGCAGAAACATGGGGGCAGCTGAAGGCCAT
TATCTTAAGCAAGTTAATGCAGGAACAGAACCAAATGGTCTCACATATAAGTGGGAGCTA
AACACTGAGTACACATGGACACAAACAGGAGAACAAAAGACACTGGGGCCTACTTGA
gcaggaagggcggcaagagggtgaaggtcaaaaaactacctattgggttctatgctcact
atctgggtgatgaaaccatttatatacccaacctcaacaaggtgcaatttacccatgtaa
caatcctgcacatgtcccctccgaacctaaaataaaagttaaaaaaaaataccgattatg

 2.04 PlyA -  22594  22589    6                               1.05
 2.03 Term -  29263  29143  121  0  1   68   49    62 0.533  -2.73
 2.02 Intr -  31069  29695 1375  2  1   78   53   421 0.378  24.55
 2.01 Init -  39788  39656  133  2  1   87   47    20 0.441  -1.85
 2.00 Prom -  39912  39873   40                              -3.65

 3.01 Init +  44761  44803   43  0  1   90   80    76 0.610   5.64
ggggagacggggaaaacaggtagtgcagatacaagtgcagaagccacagatggtgtgggt
aggcaggcccaggcctgagagccctgcttgctttctcaattgggacgcttatagcctggg
gcaagatttcagccatgctcacaagctgcctggatataaactcagtgcagttctggaagc
ATGGTGGGAGTGAGATTGGCCTTGCTGGCTATGTGGCATCTGG
gtgagccctgtcactgccagctttcccccacttccctggtgacctgtacaatgcagcaga
ggcagccataatctccctgggaacataacttcattggcctgaaagccaccccaaaaaccc
ccacagtggctgcagcaagccctgcccaaggagagtctcagctcaaacccacctaaccct

 3.02 Intr +  70798  70861   64  2  1   84   96    16 0.057  -1.14
ctaatttaagcctttagtagagctagatgtattgaggtatgggatgggttctatgactgt
cagaatgaagactagatcctttcctgggagcacgaggaatgagggtcattggcaagcctg
tgctgttgagctgcttattccttctattgtaaaggtgttcgcctctgtcttgtctttcag
TCCTCCACAAGCAACCCAGAGAAGTGTGTCTCTGTCTGCTAGAGCTTGGCCGGATTGCAG
CCAG
gtaggtcaaaccactgcaactatgtcaagacattgacgatttcagcatccaagcaacaca
gaagcttgctggcttttcattgctaatgtttaacctggatgttgagaagctactcattca
cgatgataatatgaacttcttgagggcagcagttaaccaaattaaaagtgtgccaccaat

 3.03 Intr +  82213  82354  142  1  1   27   92   144 0.880   8.13
ttttgcctctgcttagaaggatgctaattcaagagcttacaatttcaatgccagaaaaaa
agtgaatgttatttttaaaagtcagtgatttactcccatggtgctcatcatcacatgtaa
tatatggtaattgtatcattataagttatgcatatgtaatgatccagggtctttttaaag
GTATGGTGTGGAGCCTCCTGGTTTGATAAAGCTGGAAAAAGAGATTGAACAAGAAGAAAC
ACTTTCTGCCCCTTCTCCTTCACCTTCTCCTTCATCAAAGTCTTCTGGAAAAAAGAGTAC
AGGAAACTTACTGGATGATGCA
gtaagtaaaatcagtcagacttcttaccaacggttagtctttcttgcactacaaaacata
ttctgtgcaatctcgtatcagtctaatctttacctatatcaattttcttgaaatgtattt
taagcccatatgaaaaactttgtagtcctacaattcattttgagattcaaaactgaacta

 3.04 Intr +  88939  89046  108  0  0  103   65   127 0.933  11.46
ttggggcctgaactttacatggttatgatttaatgtgatattcctatgctcacatgatgt
ccatagataaataacaagtttaaagtcattaagggttcaggggccgtggagtccttggag
caaattaacataaatgcagcctaattaagacaaatgaatgtgcctgctcttctatttcag
GTGAAACGAATTTCTGAAGATCCTCCTTGCAAATGCCCAAACAAGTTCTGTGTGGAGCGG
CTCTCCCAAGGAAGATACCGAGTGGGAGAAAAGATCCTCTTCATTAGG
gtaaagttttacttttcacttatcttgtttttatgggaagattcagaatttgagttaggg
gaaatatgacagataagagcaggaacttccatatggtgcttacgtttaaagatacatggt
atgaatttttttaaagtaacatacattataatgtactactgaaggctaaatacaactgtt

 3.05 Term + 106722 106808   87  2  0  102   48    39 0.099  -2.02
agtggtgtgatctcggctcactgcaagctccgcctcccggattcacgccattctcctgcc
tcagcctcccgagtaggtgggactgcaggcgcccgccaccatgcccggctaatattttgt
atttttagtagagacggggtttcaccgtgtcacacctcagtcttaatctctcctctttag
AACACCGTCAAGTCTTCCAAGATCTTTGCAGGGCTGGAATTGGCACTCTCCTTGGGGCTT
ATTTGCTATGAAATGTTTTCTCTCTGA
agcaagatggccctttctacttgtttttgtttgcatttctcagatcagtttctttcactt
gatcatcatttcaacatgatctccttcctgacctcgcttccacagcaggttataaaaaag
gtgacaaacaccattttaagcatttagattccagcaattttcacatagccagaggctagt

 4.01 Sngl + 130236 130436  201  2  0   89   48   141 0.632   5.13
tagaccagctacaaatccttcctctgacaccaacattttctatctcattgctttcactat
gctgactgttctgtaaaatatttattatgactttgtcttctctgtctgaaatggtgccat
acactggtaattagatggagactaagccttcttaatttcatttggtgcagggctgggaaa
ATGGAGCCCTTACATAACAACGAGATGAGGACTGACCGGCAGTTGGCGTTAAGTGCTCCT
ACACATATTTCCAAGCAGATGCAAATGGAACTTTTCACCAGTCCATCATCATATGTCACT
TGCTTGCTGCTTTTCCCATGTTTGCTTCCAGAAAGAGGCTACTTGACAGTCATTTGTCTC
TACAATGAGCCTACTTTATGA
agctgaattccctcccccaccagagggaaacaattacagcaggccaggaacttttttctg
ttcagttccaatagtcagaatatttctgacccaaggccctgtccatgttgggagattggt
tctcaacatctagggcactatagtagttcacccttcaaataaagatttgaggattacatc

 5.01 Init + 136856 136915   60  1  0   76   99     3 0.119   1.50
tgcctaagttgcttaacttctcagagcatcagtattcctatctataaaaggagtaatact
gataatgacattatagattagataaagtaggtacaacctgtggaagtatcaaatgaaaag
aagtattatatgataacagtattgaccctgttctgagtttgcatatatgagattccaaaa
ATGAAGACTACATCATCCCTCTCTTCAGAGAGCTCACATATTCTGAAAAGGGACATACAG

gtaaatcagcaattgcaatattgtgggattcatgtaactgtgaaatcatgtataaactaa
acagtacacagcaaggaagggttcacttatctggggaaggagatgaacatggaagatttt
ccatattctgaaaagggacatacaggtaaatcagcaattgcaatattgtgagatgcatgt

 5.02 Term + 144891 145109  219  2  0  100   47   155 0.937   8.66
cagaaaaaaaacaggacttctttcatagactatatgctaactcagacattttgcaccaag
tagaaaaacaatgggtcatgaaatacaaaccaaaacactaatttcactagaaccaggggt
tgattcaaggtactgtaagaattctcggaatttaacacttttgatattttttcatttcag
ATGCTGCACAACAAACATGTCATGGTCCGTGTGGGAGGAGGCTGGGAAACTTTTGCAGGG
TATTTGTTGAAACACGACCCCTGCCGAATGCTGCAGATCTCCCGTGTGGATGGCAAAACA
TCCCCTATCCAAAGCAAATCTCCAACTCTAAAGGACATGAATCCAGATAACTACTTGGTG
GTCTCTGCCAGTTATAAGGCTAAGAAGGAAATTAAGTGA
aacaaattggtcatgacaaggggaccctcataatggcctgtatccacttctccagtatag
tcagtttagttcatatgttctgaaaactgttttggagaaagatagacagaaaaatgtcat
catattgaaaaatgttcaaagagtagcactatttatttttaatgcttctgtagaatatga

Predicted peptide sequence(s):


>GAS2_1|GENSCAN_predicted_peptide_1|144_aa
MGQCAFAKHIGDFAQGCLNGPLHGKGKEITAETFMEKLDNGALLCQLAETMQEKFKESMD
ANKPTKILINGGLAKKIWSLYTMEYLAAIRNQNHVLCRNMGAAEGHYLKQVNAGTEPNGL
TYKWELNTEYTWTQTGEQKTLGPT

>GAS2_1|GENSCAN_predicted_peptide_2|542_aa
MEYYAAIKNDEFMSFVGTWMKLETIILSKLSQGQKTKHRIFSLIVLEVLARAITQQKEIK
GIQLGKEEVKLSLFADDMIVYLENPIVSAQNLLKLINNFSKVSGYKINVQKSQAFLYTNN
RQTESQIISEFPFTIASKRIKYLGIQITRDVKDLFKENYKPLLNEIKEDTNKWKNIPCSW
VGTISIVKMVILPKVIYRFNAIPIKLPMTFFTELEKTTLKFICNQKRARIAKSILSQNNK
AGGIMLPDFKLYYKATVTKTAWYWYQNRDIDQWNRTEPSEITPLIYNYLIFDKPEKNKQW
GKDSLFNKWCWENWLAICRKLKLDSFLTPYTKIISRWIKDLNLRPKTIKTLEENLGITIQ
DIGMGKDFMSKTPKAMATKAKIDKWDLIKLKSFCTAKETTIRVNRQPTKWEKIFATYSSD
KGLISRIYNELKQIYKKKTNNSIKKWVKDMNRHFSKEDIYAAKKHMKKCSSSLAIREMQI
KTTMRYHLTPVRMAIIKKSGNNRWELNNENTWTQEGEHHTLGTVVEWGEGGGIALGDIPN
AT

>GAS2_1|GENSCAN_predicted_peptide_3|147_aa
MVGVRLALLAMWHLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAP
SPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPNKFCVERLSQGRYRVGEKILFIRN
TVKSSKIFAGLELALSLGLICYEMFSL

>GAS2_1|GENSCAN_predicted_peptide_4|66_aa
MEPLHNNEMRTDRQLALSAPTHISKQMQMELFTSPSSYVTCLLLFPCLLPERGYLTVICL
YNEPTL

>GAS2_1|GENSCAN_predicted_peptide_5|92_aa
MKTTSSLSSESSHILKRDIQMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKT
SPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK