GENSCAN 1.0	Date run: 15-Jan-104	Time: 00:49:42

Sequence FXYD2_1 : 10417 bp : 56.19% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   4615   4639   25  0  1   75   89    31 0.603   1.54
gaaggagcccctccatccacactgcagcttttcttgtgaccagggtaaatattacctggc
actgttaatgtttaatgcccgcacctcgtccccggccaccccgtggaggcagccagacac
tctccaaaaagcagagacagcaggaagaggggagtggaggcagcccattcacctggggaa
ATGACTGGGTTGTCGATGGACGGTG
gtgagtgtgctggtgtgcgtgcccgggcgtgtgcaatgctgggtggctctgattggcctg
cctttgtggggtcagctggaccctactcttccctctcctgccacctcagccttccagagt
acccagcccctcttcctgtcggcctcctctctaagaaaatttgcaacttaaaggaggacc

 1.02 Intr +   6576   6887  312  1  0  100   89   274 0.949  25.40
agccgcctggagcagaagcctgctggcaatggttttagcaacacccctgctcccagcctc
ccctcgcctgcttggaccctcgagggtcctctgggaagggaaggacagggaattccagct
gttcctgtggctggctcaccatcggtgactcctctcatcccacctctggctctctcctag
GCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTACTATGGTAAGCCTGGGCCCCTGCGCA
CCCTTCCTGAGCCCTCAGGACCCCTTCCACCAAGCAGCGGCCTCTCCCAGCCCCAGGTCC
ATGCTCTGTGCCCCTTATCTCCCCTGGTTACCACGGGCTGCTGCGGGCAGGCTGCGGAGA
GAGACAGCTGCTGGGAGAGACCACCCATCCCGCTCCTCTTGCCCTCTCTTTCCGGAGACT
ATGAGACCGTTCGCAATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTGGGGCTCC
TCATCCTCCTCA
gtaagtggggtggcctccagggaaggggtgctgaccagggcacctctcttctcaaggccg
ctgagcaggctggctttcgggagttgccaagggaggggtgagcctccccaccacgccccc
cactgcaggatgtgggaatgggtgcccggtggggtgccaggctcgctgggagcacagtgt

 1.03 Intr +   8398   8434   37  2  1   61   99    59 0.753   2.11
caaaaaataaaataaaataaaatataaaataaaatagagacagtcaaacgtggcctccaa
gcctgaccctgcgatgatactggcaggagggaggtaggagagactggaagaattttgagt
cttccagggtctccttggaaaattagtccatggaaacaaatctccttttctcttttcaag
GCAGAAGATTCCGCTGTGGGGGCAATAAGAAGCGCAG
gtgagcgctgcctggggtgaccgatgagggggttggggctggagaaggaggggcgggctg
aggattttgtctctgacacagtggaggatccccagcctcagagatccctagacccacccc
tccccctgccctctcacctgttgcttttccttcccccaccaggcaaatcaatgaagatga

 1.04 Term +   8597   8621   25  2  1  124   42    32 0.709   0.18
gggcaataagaagcgcaggtgagcgctgcctggggtgaccgatgagggggttggggctgg
agaaggaggggcgggctgaggattttgtctctgacacagtggaggatccccagcctcaga
gatccctagacccacccctccccctgccctctcacctgttgcttttccttcccccaccag
GCAAATCAATGAAGATGAGCCGTAA
cagcaggtatgctaggagggcctggggaaggtgcggggagggcagggcaggcttgggagc
aacagggaagaattctggctcctggactcggtaaataagaattttagggtcgtccacaca
tcagccaggtggtctgtcacccatcgtgtgtttaaaatgatggccaagggcctggcgtgg

Predicted peptide sequence(s):


>FXYD2_1|GENSCAN_predicted_peptide_1|132_aa
MTGLSMDGGGSPKGDVDPFYYGKPGPLRTLPEPSGPLPPSSGLSQPQVHALCPLSPLVTT
GCCGQAAERDSCWERPPIPLLLPSLSGDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGG
NKKRRQINEDEP