GENSCAN 1.0	Date run: 15-Jan-104	Time: 00:29:00

Sequence FOLH1_1 : 64434 bp : 35.76% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1462   1579  118  0  1   81   62   112 0.782   6.31
aacactgctgtggtggagaaactggaccccaggtctggagcgaattccagcctgcagggc
tgataagcgaggcattagtgagattgagagagactttaccccgccgtggtggttggaggg
cgcgcagtagagcagcagcacaggcgcgggtcccgggaggccggctctgctcgcgccgag
ATGTGGAATCTCCTTCACGAAACCGACTCGGCTGTGGCCACCGCGCGCCGCCCGCGCTGG
CTGTGCGCTGGGGCGCTGGTGCTGGCGGGTGGCTTCTTTCTCCTCGGCTTCCTCTTCG
gtaggggggcgcctcgcggagcaaacctcggagtcttccccgtggtgccgcggtgctggg
actcgcgggtcagctgccgagtgggatcctgttgctggtcttccccaggggcggcgatta
gggtcggggtaatgtggggtgagcacccctcgagttaggaggagggtagctgggaacggt

 1.02 Intr +   3699   3804  106  1  1   78   92   106 0.982   8.35
tttgcatgactctttttcagtgaaagtaggcaagagaaattaaaattcagaaatatctca
cctaatgtcagaggtaatattgataatttgtgttttacaaataatacatacaacaataat
gaaaaataagtcctatctataggctcgtatctcatgcctatttttggatgtatttttcag
GGTGGTTTATAAAATCCTCCAATGAAGCTACTAACATTACTCCAAAGCATAATATGAAAG
CATTTTTGGATGAATTGAAAGCTGAGAACATCAAGAAGTTCTTATA
gtaagtacatcctcgaaagtttatatggacaagttgttagaaaaatttatcattctgttt
tggtccaatattttatatataggaactggacttttttcttaaaattttatttattaaaga
tcttggatcacatttcatctgaggaggactatactttcagctaaattttgtcattacaga

 1.03 Intr +   9430   9616  187  1  1   61   83   130 0.975   8.57
agagcataaaaatttcaaagcagactttgaaaatctatttcatgcaataatactaccact
ttaattttttaacgtatcacacttcaaagtacttttgtgtaactctgctttactttgttg
atttggaataaaagttgattaaacattaatatctaaccactttcaatttttgttcaccag
TAATTTTACACAGATACCACATTTAGCAGGAACAGAACAAAACTTTCAGCTTGCAAAGCA
AATTCAATCCCAGTGGAAAGAATTTGGCCTGGATTCTGTTGAGCTAGCACATTATGATGT
CCTGTTGTCCTACCCAAATAAGACTCATCCCAACTACATCTCAATAATTAATGAAGATGG
AAATGAG
gtaaaaaataaataaataaataaaagaaacattccccccatttattctttttcaaatacc
ttctatgaaataatgttctatcccatctctaaatattaatagaaatcaatattattggat
cttgtgaatacctttaatatctcattatccgtgtcaactactttcctatgatgtttgagt

 1.04 Intr +  16977  17078  102  2  0   86   83   115 0.994  10.25
catctcgtgaattcttcacaacttctagcatagtgctgggtatctgatactatcatcaaa
atcctgaaggattcattcaccctctactgacataaaagataatattcattttttttgtgt
ttgattacagtaatcaaactttaactgttttattttgattataatattttgtttctctag
ATTTTCAACACATCATTATTTGAACCACCTCCTCCAGGATATGAAAATGTTTCGGATATT
GTACCACCTTTCAGTGCTTTCTCTCCTCAAGGAATGCCAGAG
gtaaaaacacagtgcaacaaataaaaatgacaaaaagaagccttccttctcttcatatgt
tcagccgataattaaagggtcataaagggacttttaatgtaatccaattcatttttccac
atttaagtaatgagaatgtcttagtaagaagaaggaatattgattatattttattaatgg

 1.05 Intr +  23102  23227  126  1  0   76  116    82 0.994   9.76
aattccattctcaatttaaattcatttttcccttgaatctcttctttggagctcatgcat
ttctgaccttcctgtgtgctctgacctcttccctctttcaaaaatgtccaacagtcccca
tgcagaaaaacctccttgttttatatctgactcatattaagtcattcccgatctcaacag
GGCGATCTAGTGTATGTTAACTATGCACGAACTGAAGACTTCTTTAAATTGGAACGGGAC
ATGAAAATCAATTGCTCTGGGAAAATTGTAATTGCCAGATATGGGAAAGTTTTCAGAGGA
AATAAG
gtaaggtaaaaattatctctttttttctctcccccaatgtaaaaagttatagtgggtttt
acatgtgtagaatcattttcttaaaactttatgaataccattattttcttgtattctgtg
acatgcccaccttacagagaggacacatttactaggttatatcccggggttaaattcgag

 1.06 Intr +  24016  24202  187  0  1   40   23   192 0.647   6.24
agcttatagtagcaaaaagaaaagggaaattctatccgagatgtcctttgttgtaggcct
aatgagaaaaggttgaagataaagttctggtactcatttaagtgtaatattgaaaattga
tattaccgaatctggaacaaccaatttaaaataaggaaagaaagacactgtgttttctag
GTTAAAAATGCCCAGCTGGCAGGGGCCAAAGGAGTCATTCTCTACTCCGACCCTGCTGAC
TACTTTGCTCCTGGGGTGAAGTCCTATCCAGATGGTTGGAATCTTCCTGGAGGTGGTGTC
CAGCGTGGAAATATCCTAAATCTGAATGGTGCAGGAGACCCTCTCACACCAGGTTACCCA
GCAAATG
gtgaatgatcaatccttgaatatcataggaaacttaacatttgaaagagactttattaaa
gaatttcctttggtacaatggactaagcatgtctttttttattctctttgcatttaagaa
tgaaagaattttgaactctaaagtgattggttcaggccccttacccccttattttgaaac

 1.07 Intr +  26629  26722   94  2  1   62   89   128 0.952   8.40
tcacaagcaatgtatgaggatttcagttgctctgcattctcgctaacatttgaattgtta
atctgttttactttaacaattctagcaaatgtgaaattagaatgtatttaatgtgattta
tagagaaccgtttgaatgaaactgagtttttactggaaatatggcaattttttttttcag
AATATGCTTATAGGCGTGGAATTGCAGAGGCTGTTGGTCTTCCAAGTATTCCTGTTCATC
CAATTGGATACTATGATGCACAGAAGCTCCTAGA
gtaagtttgtaagaaaccatggatggctatttgggtaattttcttattgacagttttcaa
atgttaggcttttatctccattttttagtacttaaattttccaacatgggtgttgcttgt
aattttatcagtataaaatagaagagtggttctgttctggaatttagtatatacatgagt

 1.08 Term +  27033  27108   76  0  1   64   44   102 0.942  -0.27
gtataaaatagaagagtggttctgttctggaatttagtatatacatgagtatctagtgta
tgacagccatgaaaatgaacctttcagatgtttaacttcagggaacctaattgatcaatt
gctccagacattgtgctttgaaaccccactatatttttgtcaagaccatgcttcctgtag
GTGTTCTCGGGCAATGACTCAGTGTGGCAAGGATACTACTGCAGGCCTGTTTCTGGAAGG
CACTGGACTCCTCTGA
tgcaaaactttggcccagggactccttgatagcctcgcttaaatagatgctgcacccaac
actcctctttcttttcctcctccctttttcctttattcaatattagacctaccttgcagt
ctaaggactttctcagggtttcctagctctctcctcattttccacacatgcttttcccta

 2.01 Init +  34904  34979   76  1  1   84  103    36 0.983   6.00
tacactggtgtgttagtaagtttgtatgccttttctcctgttaatcagttttcagtttat
tttaccagacttgaaccttcaaaggcagaggggaaaattcccttaaaccttatagtgtta
atctgttaaccagtttttttttttaagaatgtcttttatttttgcattagaaaagtcaag
ATGCACATCCACTCTACCAATGAAGTGACAAGAATTTACAATGTGATAGGTACTCTCAGA
GGAGCAGTGGAACCAG
gtaaaggaatcgtttgcttagcaaatattgatcaagtaactgttatgtgctggatactac
caagctctgggagtgcaaagtgaatcaaaacaaacaaacaaacaaacaaacgaagaaaat
cggtggaactcacctaaaaacaaaggaaataagtatgaaataattttgtattgtggtaca

 2.02 Intr +  36395  36514  120  0  0   92   85   201 0.962  19.75
tcagatagaagaaacacatattaaaatcagaaataacatattttcacaaatcttggggaa
cctagccttttttttttttctgaggcgtgagtgctttgtatttagatgctattgagtcat
ttgcaattttctcttttattgacctgaaatgacaaataatcttgtatctatgctttctag
ACAGATATGTCATTCTGGGAGGTCACCGGGACTCATGGGTGTTTGGTGGTATTGACCCTC
AGAGTGGAGCAGCTGTTGTTCATGAAATTGTGAGGAGCTTTGGAACACTGAAAAAGGAAG

gtaatacaaacaaacagcaagaaaaaaaacagcctatctgagtctcagtttagtcttctg
taaagggagtataaaaatactacctcaaccattacatgtgtttggtaaaaatactaatac
aattttcagtgttggttggttaattatattgtttatttatttttgcatttatttatataa

 2.03 Intr +  45099  45166   68  1  2  121   61    37 0.087   2.01
cagtgtgggccatggtgagaatgatggactttacagagttagttgggaagccattggaga
gttacagttgaaatcaggttttaaaacaatcattctggtaggaatttagcagtggtcttt
gaagaaaataataacagaaagaaattaaattttaaaatctattcttttcttatttttcag
GAAACTACACTCTGAGAGTTGATTGTACACCGCTGATGTACAGCTTGGTACACAACCTAA
CAAAAGAG
gtatataattacatataatttaagaaaacccaaattctacaaatgatgttttcttgaggt
attatgttaaacataggtggtgttttataacttcttgtcttcatttcatataacatatat
gacatcacatcttcacagaccatcacatctagtaaactgtttacacagattgcctcattt

 2.04 Intr +  51828  51919   92  2  2   43   97    70 0.867   1.27
atcacatgagtattttcccacttgtcagaaacttataattcttgatgactgctaatgtat
ggatagcatcccttgtttttgctgaattgtggcttagttactcacttctggttaatggac
atctagtttttaatatatctgatttgtaagtattctctttttttcttttaatttgtgtag
CTGAAAAGCCCTGATGAAGGCTTTGAAGGCAAATCTCTTTATGAAAGTTGGACTAAAAAA
AGTCCTTCCCCAGAGTTCAGTGGCATGCCCAG
gtaaacaaatgaatgaagtttccactgaattcagtgtgggattgttttgaaaataaaagc
acattttctttcaatcattaagtgaaaaattaagtttcaaaatggtctaaaatctgataa
agaaaagcattactttggttcacaaataaaatattactatgtgttttgtagttaaatctg

 2.05 Intr +  53064  53154   91  0  1   60  106    64 0.969   4.48
tagaaggagatattttgtgatcaaaattaatattcttttcatgtttttgctgcatgtcta
aagctgtatgtttaaaattacatttataatagtaagaatggggtttagtttaatggacat
gtaatctgtgcttaatgaacaaattactttgaaataattctgttgttttatctctaaaag
GATAAGCAAATTGGGATCTGGAAATGATTTTGAGGTGTTCTTCCAACGACTTGGAATTGC
TTCAGGCAGAGCACGGTATACTAAAAATTGG
gtaagtgaatctcaaattatctaagattatttatgaatatgttttaactaaacaaataat
tctgactccaaaaagtgactcaagcattagaggaatagagaaatttgaaagcagagggag
aagtctcaatggttgacagtatcactactacgtaggataactcctatatcttgtattcca

 2.06 Intr +  55379  55643  265  1  1   72   76   178 0.974  11.16
aagcctggaatgtgtttatgtatcataatattagccatttaggatgtagcttattgagat
gcttaagtactttccttgatccatcactgaccaatcttactaatactaatagtaaatatg
gtgctaatcattttttgtaagctatcctataagagatatgttttgttgttttttctgtag
GAAACAAACAAATTCAGCGGCTATCCACTGTATCACAGTGTCTATGAAACATATGAGTTG
GTGGAAAAGTTTTATGATCCAATGTTTAAATATCACCTCACTGTGGCCCAGGTTCGAGGA
GGGATGGTGTTTGAGCTAGCCAATTCCATAGTGCTCCCTTTTGATTGTCGAGATTATGCT
GTAGTTTTAAGAAAGTATGCTGACAAAATCTACAGTATTTCTATGAAACATCCACAGGAA
ATGAAGACATACAGTGTATCATTTG
gtatgttacccttcctttttcaaattcctcatctgtatggttctattaatctcctaaata
taatgggctatcttaggtcatttattatttattgctatttcaagtgatccaatattctgt
ttatgtctataaatgtattttccattttatggatgctcacgtcttataatataaaaatat

 2.07 Intr +  58514  58607   94  0  1   28   66    79 0.384  -2.20
ggaagagacatgactttatcctgcttttcttgtatcacttcttgccccatcaaagaatat
aagacgttaacacaggatacagagaaagagaagtgtgtgtgtgtgtgtctgtgtgtgtgt
gtgcacgcacgcgcacgcgcgcatttacgtgtgtgtggccacgagtttttgtacttgtag
CAATTCTTTGTGAATTTGATTCCGAAACCCATTGCATCTTATTGAAATTATCCTTCATTC
GATTGTCTCAACTGTTTATCGGAGTTGCTAACAG
gtattctgtgtttcatttacctttatactatcacagaatctgaattcatgatgccaaata
cataaatgttaaaaatagctcaaatccaaattatgggagtttaagttgttcctattttcc
ttttgtcggcaaggtgcagttgaaagaacaatatcaatctcctatttcactctaaaactt

 2.08 Term +  62926  63115  190  1  1   45   48   202 0.749   7.84
attaattactatagatttcatataatagtcttcagagatgattgaacttggaagttcagt
tgacaagtggcttgttcaaattgttataggaatatgcaatccaggaattgcagagtgctc
ttgtgtttctcttgtatatcatttgggcacctaataaacagcaaacgattttatcaacag
GCATGTCATCTATGCTCCAAGCAGCCACAACAAGTATGCAGGGGAGTCATTCCCAGGAAT
TTATGATGCTCTGTTTGATATTGAAAGCAAAGTGGACCCTTCCAAGGCCTGGGGAGAAGT
GAAGAGACAGATTTATGTTGCAGCCTTCACAGTGCAGGCAGCTGCAGAGACTTTGAGTGA
AGTAGCCTAA
gaggattctttagagaatccgtattgaatttgtgtggtatgtcactcagaaagaatcgta
atgggtatattgataaattttaaaattggtatatttgaaataaagttgaatattatatat
agttatgtgagtgtttatatatgtgtgtgtttatattgtttatcttctccctatggatta

Predicted peptide sequence(s):


>FOLH1_1|GENSCAN_predicted_peptide_1|331_aa
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP
NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA
RTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK
SYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY
DAQKLLECSRAMTQCGKDTTAGLFLEGTGLL

>FOLH1_1|GENSCAN_predicted_peptide_2|331_aa
MHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFG
TLKKEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRI
SKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKY
HLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFAIL
CEFDSETHCILLKLSFIRLSQLFIGVANRHVIYAPSSHNKYAGESFPGIYDALFDIESKV
DPSKAWGEVKRQIYVAAFTVQAAAETLSEVA