GENSCAN 1.0	Date run: 15-Jan-104	Time: 02:21:16

Sequence FGF3_1 : 11612 bp : 60.79% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1692   1911  220  2  1  107   79   423 0.968  40.26
ctttctctctctcgcccacccttcccccttcttcccccacctttcccgcgaagccggagt
cagcatctccaggcgcgggatcccgctccgagcacctcgcagctgtccggctgccgcccc
ttccatgggcgccgcgctcgcctgcagccgccgccgccgcggggcgggcgcgatgccacg
ATGGGCCTAATCTGGCTGCTACTGCTCAGCCTGCTGGAGCCCGGCTGGCCCGCAGCGGGC
CCTGGGGCGCGGTTGCGGCGCGATGCGGGCGGCCGTGGCGGCGTCTACGAGCACCTTGGC
GGGGCGCCCCGGCGCCGCAAGCTCTACTGCGCCACGAAGTACCACCTCCAGCTGCACCCG
AGCGGCCGCGTCAACGGCAGCCTGGAGAACAGCGCCTACA
gtgagtgccggacgctgcggggccccgggggaagcggcgccgggaggggtcgggcccggg
agaaggcgcgctgcggggccccgcgggggaggcggcgccggggaggggtctggcccggga
gaaggcatggtgcgcccggggtgtccgggaaaagaccgtctgcctcccgctgccagaagg

 1.02 Intr +   4202   4305  104  0  2  102  109   157 0.994  20.26
tctctacctcctgtccggtgacttctcccttcctgaacttccactcactccccgacctgt
ggggtgtgtgctaccctccccagccctgagcccggggtgtggctttgggcagggccagct
gggcctcagccgccccctccgtgggggcggcgggagtgaggcacctctcatttcttctag
GTATTTTGGAGATAACGGCAGTGGAGGTGGGCATTGTGGCCATCAGGGGTCTCTTCTCCG
GGCGGTACCTGGCCATGAACAAGAGGGGACGACTCTATGCTTCG
gtgagtccaggctgtcacgtgggtgggcgctgacggagtagcggtctggcctgcacatca
agccaggggacgggggatgtgggcagtagaatgctttgccaagggtacacgggacccaag
ctaggaccagaccctggcccagggctccacgcccagtgatctttggctgtgtctgttaga

 1.03 Term +   9681  10076  396  2  0  123   37   519 0.876  46.45
ggaaggacatgctgggcagagggcagggcctaggcaaaggtgtgactggctgagagtgcg
ctggggtttggcactggaccgaacagcctcacaggaggggagggaggcatcaggcaaccc
tgggccctgacgctgccacagtctccccggggcactgaccatgatatctcatccccgcag
GAGCACTACAGCGCCGAGTGCGAGTTTGTGGAGCGGATCCACGAGCTGGGCTATAATACG
TATGCCTCCCGGCTGTACCGGACGGTGTCTAGTACGCCTGGGGCCCGCCGGCAGCCCAGC
GCCGAGAGACTGTGGTACGTGTCTGTGAACGGCAAGGGCCGGCCCCGCAGGGGCTTCAAG
ACCCGCCGCACACAGAAGTCCTCCCTGTTCCTGCCCCGCGTGCTGGACCACAGGGACCAC
GAGATGGTGCGGCAGCTACAGAGTGGGCTGCCCAGACCCCCTGGTAAGGGGGTCCAGCCC
CGACGGCGGCGGCAGAAGCAGAGCCCGGATAACCTGGAGCCCTCTCACGTTCAGGCTTCG
AGACTGGGCTCCCAGCTGGAGGCCAGTGCGCACTAG
ctgggcctggtggccaccgccagagctcctggcgacatcttggcgtggcagcctcttgac
tctgactctcctccttgagcccttgcccctgcgtcccgcgtctgggttctcagctatttc
cagagccagctcaaatcagggtccagtgggaactgaagagggcccaagtcggagctcgga

 2.03 PlyA -  10410  10405    6                               1.05
 2.02 Term -  10583  10463  121  1  1   19   43   182 0.899   5.68
 2.01 Init -  11239  11166   74  1  2   76   88    15 0.545   0.98

Predicted peptide sequence(s):


>FGF3_1|GENSCAN_predicted_peptide_1|239_aa
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH

>FGF3_1|GENSCAN_predicted_peptide_2|64_aa
MVLTVPGSGEPPHLDPAHPAKCQERELKCTFSPISGNAVFLLKQQLTQADASADSAVLEA
STFQ