GENSCAN 1.0	Date run: 15-Jan-104	Time: 00:12:07

Sequence EHF_1 : 42118 bp : 43.77% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2538   2543    6  2  0  112   88     0 0.329   3.27
ccatgctcccaggatggtgggagtgtgtgtttttaagatggagagtgtatgcttctgggt
tcaagttcacaggtgtctctgctggttatctgcactcaccttggtaacagggagaaagtg
agtgaatggattccaagaacttactgatggaagtctaattcaggagttggttctgcagcc
ATGGAG
gtaaagatgtgttgatagtctttcaatgtgtaaaagggcaattagagattctgtgtgact
gtgtgttaattccactggggtcaggggaaaaatttatttctaacagaaaagaagaagata
cgttattaggaagaatttcatggctaggagatactatcagaaaaggctcttaagagattt

 1.02 Intr +  14647  14761  115  0  1   47  103    89 0.578   6.32
gctgtcatcacaaaagtaattatttaaaaggactaattgctcctttggcttcagaggtaa
aaatgcccacatggcagccagttctgtggcagtttggggataatgtggttggatgaataa
gggagctaggaagaaggctgatggtggccttgactctcaatcccctggggctggggacag
GGAATGCAGGTGCAAGCCCTGGTTAAGATCTGCTCCGTGGCCCTGGTGGTTCCCAGTGTA
CCTTCACCCTTGCAGCAGGAGCAAACCATGCTGTCTGGCCTGAGGTCTGATTCAG
gtaaagcataaacaattatggaccagtcgatttcccaaatacaaaattaaaataacttta
ttgagtcatagggggataatttacattatatatgcacgtatgtatttatgcatgcatatg
aatatatatacatatatttgtatataagcttgataaaggtgtaaggcagcagacggcaca

 1.03 Intr +  19746  19792   47  1  2  104   99   -11 0.504  -0.27
tcacatttgttatccacgatctcattccatctcaacagtcctgtgaggctgttggggcaa
gtgtcttcactctacgcctgaaaaactatgcctcagaggagggtaggactcggccaaagc
ccttctgctacactggccctgggcctcatgtgcccaccctgaggacatctttccctgcag
CTCCCTGCCCAGTTGGAAATGCTGACCTTCTTTGCTTACAAGCCCAG
gtgagctcaagcgaactctgactcactaagggttaagccacacaaactcttttatgagtg
gaaaccacttaatgtgccctgtaaaaaagggcccctcaccatgctggctgctttcccttg
gaaagggagtgccagcagggagcagggctatgcacaggccatctttttgcaggaggatgg

 1.04 Intr +  22755  22854  100  2  1   70   95    56 0.620   4.18
gaaatttttaattgctgtgagttttgcttttacaaaaaacgctttggcaatgggtggcag
gcaatgggtggaaggacaaattctctttattttcttcctaaatttactctgtgatctgca
ctttccaatgacatttgtccaagaggcactgactgaacaggctgtttgatcccctaacag
ATCATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCAC
CAGCCGCCAGCCTGGACAGACAGCTACTCCACGTGCAATG
gtaagagggcctgtgggtgttggtgtcactgctgtgctgtgtgggctctttgctttaatt
cctctcacaacctaatgtttgaaaaatataggctttacagcagaagatgtgggacaagaa
ggaatggagaaaactcagttttggagttccctaccagcccccagcgttccagacaaaagc

 1.05 Intr +  26566  26811  246  2  0  100   14   249 0.984  16.13
ggtaggtagcaggctagggaggacatgaaaatgcacttctgctccatcacccatgctggc
acatacacggactgtggttgtgtctctgagatatctggcagccaacagtacatccctgtg
tcagatactatggccaggaacagccaggggtcactcatgaggctgcttcctgttttgcag
TTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGT
ACCAGGTGTGGGAGTGGCTCCAGCACCTCCTGGACACCAACCAGCTGGATGCCAATTGTA
TCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTGCAGGAGT
TCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGT
GGAACG
gtgactctctctttctgtgtctctccctaccctgctaggagccagctggaagaatagaga
ttctgcagatgacaggattctttgtcagggacaagaaagagtggtctcacctccaaatta
ccatgtcccaagacagagaaatggaaggaagatgaaaggacaggattgaagcatagggta

 1.06 Intr +  29146  29208   63  2  0  121  105    48 0.983   8.49
agagactgcaggcttgagtttgtagaggctgacagagaaaccacctcccataaacaaaca
taggtgaccaggcagtaggatggcagaagctctgcaaagatgccagttctgtccttattt
aagcatccagttctggctccatctgggccctctctgactatcccaatctgtccttcacag
GCCAGTGCAGTAGTGACCTGTTCCAGTCCACACACAATGTCATTGTCAAGACTGAACAAA
CTG
gtgagtagtagtggacaaagggagccaacctagcctggcaaagctccggggaggacagtt
gggagagggcaagagagaatgtgggggcaagtttttgcaggaaacacagggaggcctttt
ccctggctgtctctgatgggccacccccaccatgaatctcattcttgcccttgcgaccag

 1.07 Intr +  31669  31737   69  2  0   90   61    86 0.949   5.25
aaaggaaaattagacaacattattataaagtaacgcagctgaagcagaatcatatccctt
gtctctgaggaccactcctcaccccccatactttgttgatgaacaatgaattagaaaacg
cagcctcttctccctggggaaaagagatcgctgactattctccttctctattttttgtag
AGCCTTCCATCATGAACACCTGGAAAGACGAGAACTATTTATATGACACCAACTATGGTA
GCACAGTAG
gtaactaactccctgacacttaaggccctttacattcttattcagtttgtctaagagcca
cagtgttctattgtgaggtggggggagggggtgctctaaatgtcctttatcttttcatgg
ccacagatttgttggacagcaaaactttctgccgggctcagatctccatgacaaccacca

 1.08 Intr +  31864  31932   69  2  0   90   99    65 0.945   6.95
acacctggaaagacgagaactatttatatgacaccaactatggtagcacagtaggtaact
aactccctgacacttaaggccctttacattcttattcagtttgtctaagagccacagtgt
tctattgtgaggtggggggagggggtgctctaaatgtcctttatcttttcatggccacag
ATTTGTTGGACAGCAAAACTTTCTGCCGGGCTCAGATCTCCATGACAACCACCAGTCACC
TTCCTGTTG
gtaagctgtcatcacatctgaggctgggtatgcctaatgcttagggagaatcagtgggaa
ttaccaacactctacatttctgcctttctggagtctttctaattaaagggctaggaaagg
gatggggttaccattagacgaggtttgcttttgaggcaatatttgtacatcgaagatgac

 1.09 Intr +  37035  37097   63  1  0   91   98    63 0.560   6.29
tgcatcatttttctccatagcatttatcatctctgttttgtttggttcactagcacatac
tcaaaggtgccaggcatgcagtaggtgctcagtaaatattgtttaaatgagtggatgcat
gaataaaaaagagaattataggaaataggtcaattaaacgcctctcatttttctccttag
CAGAGTCACCTGATATGAAAAAGGAGCAAGACCCCCCTGCCAAGTGCCACACCAAAAAGC
ACA
gtaagttggctggctttcagatggcctttggtccttcccatcacatcgggcacatctgga
ggccactagttttttggcaaatatcgcctctgtctgctgccttcatgtcttcatcccaaa
cagggtggagtgagaaaatagaggcatcacttgctagcaaagtaagccccctctgcagct

 1.10 Intr +  38660  38855  196  0  1   78   78   133 0.987   9.77
tttattcttaaatacctttttaatgtccaacatctggtgattctgcgatccatcttccct
gacaagtaggggagaaatgagtatctcctacttgcaggaagatgacctaactcaatgctc
tctgccctatctttgctgtgacttagatcattagtaacctgcctttctgcttttcatcag
ACCCGAGAGGGACTCACTTATGGGAATTCATCCGCGACATCCTCTTGAACCCAGACAAGA
ACCCAGGATTAATAAAATGGGAAGACCGATCTGAGGGCGTCTTCAGGTTCTTGAAATCAG
AGGCAGTGGCTCAGCTATGGGGTAAAAAGAAGAACAACAGCAGCATGACCTATGAAAAGC
TCAGCCGAGCTATGAG
gtgaggagtttcatgtctctgaaaacaaaaaggctgtacgacccattatttacctagcaa
ccttcatcggatcagtcaccttatgcaatctcctttgttacagatattactacaaaagag
aaattctggagcgtgtggatggacgaagactggtatataaatttgggaagaatgcccgag

 1.11 Term +  38959  39058  100  1  1   95   48   108 0.990   5.10
gaggcagtggctcagctatggggtaaaaagaagaacaacagcagcatgacctatgaaaag
ctcagccgagctatgaggtgaggagtttcatgtctctgaaaacaaaaaggctgtacgacc
cattatttacctagcaaccttcatcggatcagtcaccttatgcaatctcctttgttacag
ATATTACTACAAAAGAGAAATTCTGGAGCGTGTGGATGGACGAAGACTGGTATATAAATT
TGGGAAGAATGCCCGAGGATGGAGAGAAAATGAAAACTGA
agctgccaatactttggacacaaaccaaaacacacaccaaataatcagaaacaaagaact
cctggacgtaaatatttcaaagactacttttctctgatatttatgtaccatgaggggaac
aagaaactacttctaacgggaagaagaaacactacggtcgattaaaaaaattattttgtt

Predicted peptide sequence(s):


>EHF_1|GENSCAN_predicted_peptide_1|357_aa
MEGMQVQALVKICSVALVVPSVPSPLQQEQTMLSGLRSDSAPCPVGNADLLCLQAQIMIL
EGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLL
DTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQ
STHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAE
SPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSE
AVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN