GENSCAN 1.0	Date run: 15-Jan-104	Time: 00:54:22

Sequence DPAGT1_1 : 7531 bp : 49.82% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1188   1348  161  2  2   88   50   293 0.988  22.80
gagaggttccccggtgtcccgacggcggctcaagtcagagttgctgggttttgctcagat
tggtgtgggaagagcctgcctgtggggagcggccactccatactgctgaggcctcaggac
tgctgctcagcttgcccgttacctgaagaggcggcggagccgggcccctgaccggtcacc
ATGTGGGCCTTCTCGGAATTGCCCATGCCGCTGCTGATCAATTTGATCGTCTCGCTGCTG
GGATTTGTGGCCACAGTCACCCTCATCCCGGCCTTCCGGGGCCACTTCATTGCTGCGCGC
CTCTGTGGTCAGGACCTCAACAAAACCAGCCGACAGCAGAT
gtgagcagcggcacacgggtccgggcagggggcaagggctaaggaaggagtggctagggc
aggggcgggaaccggggtgcttgaccacacgtgaagactcagaactaacccaggcagcct
ggaactcggagaggtgatgagcagaacttactcgcattggggaaaggatgggtagggacc

 1.02 Intr +   1705   1871  167  1  2   70   67    77 0.782   3.40
gacccttgggtatatctgggactctggcagtggtgctttcctccctccgcccccctcacc
acttaccagaataaaaaaccgggaatgagaagaccactttgggttactgtaacacctgca
ctagtgagtgaccacgccccctttcctcttccccctcgcccccttgctgctgggccacag
CCCAGAATCCCAGGGAGTGATCAGCGGTGCTGTTTTCCTTATCATCCTCTTCTGCTTCAT
CCCTTTCCCCTTCCTGAACTGCTTTGTGAAGGAGCAGTGTAAGGCATTCCCCCACCATGA
AGTAAGTGGGTTCGTGGGGGTGATTGCCTGTGGCTGGGACCTGGGAG
gtacctgagagaactggggttatttgggcttgtggggaggggctaagaaattatcagaaa
agacaggaattcttaaaaggtggaatgggagcaggcttgagtcatggacctgcccgagcc
tcccccagtttgtggccctgataggtgccctccttgccatctgctgcatgatcttcctgg

 1.03 Intr +   2016   2213  198  1  0   70   69   218 0.936  17.42
tcgtgggggtgattgcctgtggctgggacctgggaggtacctgagagaactggggttatt
tgggcttgtggggaggggctaagaaattatcagaaaagacaggaattcttaaaaggtgga
atgggagcaggcttgagtcatggacctgcccgagcctcccccagtttgtggccctgatag
GTGCCCTCCTTGCCATCTGCTGCATGATCTTCCTGGGCTTTGCGGATGATGTACTGAATC
TGCGCTGGCGCCATAAGCTGCTGCTACCTACAGCTGCCTCACTACCTCTCCTCATGGTCT
ATTTCACCAACTTTGGCAACACGACCATTGTGGTGCCCAAGCCCTTCCGCCCGATACTTG
GCCTGCATCTGGACTTGG
gtaggtagtcctaccactgctgcccctatggcacctacttcagggaacccttcctggtgc
tccacattctcctccaagtgttccttttttgtctctgtgtcttcccagatcctttctggt
agcccttcatcctatcgtccgtcctcaccacttttctaaaaattcttaaatcctcctccc

 1.04 Intr +   2435   2581  147  0  0  126  100   157 0.976  20.91
agggaacccttcctggtgctccacattctcctccaagtgttccttttttgtctctgtgtc
ttcccagatcctttctggtagcccttcatcctatcgtccgtcctcaccacttttctaaaa
attcttaaatcctcctcccctaggtggcactacttcttttcctaccatctctccccgcag
GAATCCTGTACTATGTCTACATGGGGCTGCTGGCAGTGTTCTGTACCAATGCCATCAATA
TCCTAGCAGGAATTAACGGCCTAGAGGCTGGCCAGTCACTAGTCATTTCTGCTTCCATCA
TTGTCTTCAACCTGGTAGAGTTGGAAG
gtaggtgggattgggggtggggagagagaagtctgagtgttaaaggtgtggcctgatata
tgactttgggaaattcaggggaaaaaagcaatatgcatagtaattatagaagataaggga
agctacttactttgcaaataacaatgcagatttattaaaagtgagaaagaaaaatagtag

 1.05 Intr +   4356   4440   85  1  1  107  119   -45 0.976  -0.62
acgaaagaggtggaatattgggaattgccttgggtgacataaaaggagtattgagttctt
aaaagtgacttgggtgaggtggatgataacagctgtaaacagaacttagacaaaaatagg
accaaggtttgcagaggaagtgggtattaacttttccttctttcttccttgcttccaaag
GTGATTGTCGGGATGATCATGTCTTTTCCCTCTACTTCATGATACCCTTTTTTTTCACCA
CTTTGGGATTGCTCTACCACAACTG
gtaagtaggcctgtggataaggggacaactacctgaacacatggcaaagatggcccttat
cataacccaccttgtggtggtgaagctaaacctgcgcatacctctatggagttttctgcg
tcttcagttggtcgtattctgaaatttctctctacccagtagtagttagggatgagtgcg

 1.06 Intr +   4800   4988  189  0  0  113   68    90 0.985   8.20
gtggaggccccaggaatagatgaattcagggccttggatcctgcagagttgctgcacaac
tggagtctcctctgagtcagaactagggtcagggctagtccagtgcccatagggtgtgat
gtgagagaagggattggtaatgcctcttgccactggctcggatcctcttcccccacacag
GTACCCATCACGGGTGTTTGTGGGAGATACCTTCTGTTACTTTGCTGGCATGACCTTTGC
CGTGGTGGGCATCTTGGGACACTTCAGCAAGACCATGCTACTATTCTTCATGCCCCAGGT
GTTCAACTTCCTCTACTCACTGCCTCAGCTCCTGCATATCATCCCCTGCCCTCGCCACCG
CATACCCAG
gtagccgctttttggcttgaaatggacatcatagccttttcacttgggatatctaatgcc
agcctatacatttgctgtgcaaagggagtgggcccaaagaagggctatttccatgtgagt
agccctttataacttacaaagcacatttatttgcataatctgctacagtggttctgataa

 1.07 Intr +   5292   5379   88  0  1  104   87    17 0.989   3.17
cctttataacttacaaagcacatttatttgcataatctgctacagtggttctgataacag
taagcagcagagccagaaatagatctcaggttgactccacattcaatgctcttcctatta
gccacagggaggagggttcaaatagtggcccagtcacatgaagctatcttccccccgcag
ACTCAATATCAAGACAGGCAAACTGGAGATGAGCTATTCCAAGTTCAAGACCAAGAGCCT
CTCTTTCTTGGGCACCTTTATTTTAAAG
gtaacagggtaacaaggaggtaaggccctaggctgccatcctgaccttgaggaatgggga
acctagtcctacatcagatccaaggggaacttgaaagcattaaatagatccacattccta
aagcataggtattagctgaggttctcttcacctctggtccctccaggtggcagagagcct

 1.08 Intr +   5546   5701  156  1  0  102   94   158 0.909  18.01
cctttattttaaaggtaacagggtaacaaggaggtaaggccctaggctgccatcctgacc
ttgaggaatggggaacctagtcctacatcagatccaaggggaacttgaaagcattaaata
gatccacattcctaaagcataggtattagctgaggttctcttcacctctggtccctccag
GTGGCAGAGAGCCTCCAGCTGGTGACAGTACACCAGAGTGAGACTGAAGATGGTGAATTC
ACTGAATGTAACAACATGACCCTCATCAACTTGCTACTTAAAGTCCTTGGGCCCATACAT
GAGAGAAACCTCACATTGCTCCTGCTGCTGCTGCAG
gtgaggatgggaatcgagtttatacctccgtgtctccctttctgcgtgattcttactcca
gtccatttctccttgcagatcctgggcagtgccatcaccttctccattcgatatcagctc
gttcgactcttctatgatgtctgagtcccttgatcattgtcctttacctcacagtctcta

 1.09 Term +   5780   5845   66  1  0   97   47   108 0.907   5.54
gaattcactgaatgtaacaacatgaccctcatcaacttgctacttaaagtccttgggccc
atacatgagagaaacctcacattgctcctgctgctgctgcaggtgaggatgggaatcgag
tttatacctccgtgtctccctttctgcgtgattcttactccagtccatttctccttgcag
ATCCTGGGCAGTGCCATCACCTTCTCCATTCGATATCAGCTCGTTCGACTCTTCTATGAT
GTCTGA
gtcccttgatcattgtcctttacctcacagtctctaggattcctgactcaggctgacctc
tctctctggtcccagactgcctccttgcccaggcctctctcactcttcatactcctccag
attttgttctcagcattttcctttctctgtgatcattggcatcctgggcgtttcttgccc

Predicted peptide sequence(s):


>DPAGT1_1|GENSCAN_predicted_peptide_1|418_aa
MWAFSELPMPLLINLIVSLLGFVATVTLIPAFRGHFIAARLCGQDLNKTSRQQIPESQGV
ISGAVFLIILFCFIPFPFLNCFVKEQCKAFPHHEVSGFVGVIACGWDLGGALLAICCMIF
LGFADDVLNLRWRHKLLLPTAASLPLLMVYFTNFGNTTIVVPKPFRPILGLHLDLGILYY
VYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNLVELEGDCRDDHVFSLYFMIP
FFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFMPQVFNFLYSL
PQLLHIIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSET
EDGEFTECNNMTLINLLLKVLGPIHERNLTLLLLLLQILGSAITFSIRYQLVRLFYDV