GENSCAN 1.0	Date run: 15-Jan-104	Time: 01:43:49

Sequence CTSF_1 : 7507 bp : 57.73% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1291   1503  213  0  0  106   76   417 0.997  39.21
tgcgcgccccacgtgcctcctgtaaacaagagaacgcgcaggcgccgcaaaccagcgccc
attggtcggcgtgccgtcgccccgctggagggaggactcaggccccgctggccgcgggct
cggtacccggtgggtcggtggagcgtctgttgggtccgggccgccggcttcgccctcgcc
ATGGCGCCCTGGCTGCAGCTCCTGTCGCTGCTGGGGCTGCTCCCGGGCGCAGTGGCCGCC
CCCGCCCAGCCCCGAGCCGCCAGCTTTCAGGCCTGGGGGCCGCCGTCCCCGGAGCTGCTG
GCGCCCACCCGCTTCGCGCTGGAGATGTTCAACCGCGGCCGGGCTGCGGGGACGCGGGCC
GTGCTGGGCCTTGTGCGCGGCCGCGTCCGCCGG
gtgaggacgcgccgggggcgggggcgccaggcccgggtccaagggataggagctttgacc
taacattgggatggggcctgcccgctggacgaaccgatctctggtgatggggaatgggca
gcgccgcacgggcggggccttgggcgccgtcaagggccgactgtgcccgcctcacctact

 1.02 Intr +   1695   1793   99  2  0  104  105   131 0.997  17.87
ccgggggcgggggcgccaggcccgggtccaagggataggagctttgacctaacattggga
tggggcctgcccgctggacgaaccgatctctggtgatggggaatgggcagcgccgcacgg
gcggggccttgggcgccgtcaagggccgactgtgcccgcctcacctactcctctctccag
GCGGGTCAGGGGTCGCTGTACTCCCTGGAGGCCACCCTGGAGGAGCCACCCTGCAACGAC
CCCATGGTGTGCCGGCTCCCCGTGTCCAAGAAAACCCTG
gtgagtgatgaggctcttggggttccccgccccgaggccgagtaaagcagcagttggatg
atgacgggtcaggtcaagacgcagggatctgaggtagctgctgccccaccttgagccact
tcccaggccccgagggctggaaaccaagatgctatgaaggggaggatgccccggtgcagg

 1.03 Intr +   2115   2333  219  2  0   78   94   179 0.998  17.22
aaccaagatgctatgaaggggaggatgccccggtgcaggccgtgcctcactgtccactgt
gatggggtgattgccttaggggtggctctcatctgaggagcctccagctccatcttggcc
agatcttgctccccagatccagatccaggcccccagagcagcttcttcctctccctccag
CTCTGCAGCTTCCAAGTCCTGGATGAGCTCGGAAGACACGTGCTGCTGCGGAAGGACTGT
GGCCCAGTGGACACCAAGGTTCCAGGTGCTGGGGAGCCCAAGTCAGCCTTCACTCAGGGC
TCAGCCATGATTTCTTCTCTGTCCCAAAACCATCCAGACAACAGAAACGAGACTTTCAGC
TCAGTCATTTCCCTGTTGAATGAGGATCCCCTGTCCCAG
gtgaggagccctcagcttgaggagccctcagcttgaggagccagccgctgcctcatcacc
cttctcccttccctctggagtgggtttctctggtcagcctaaagactggtctgcctatcc
aggacttgcctgtgaagatggcttcaatcttcaagaactttgtcattacctataaccgga

 1.04 Intr +   2456   2531   76  1  1   73  100    67 0.939   6.64
cagaaacgagactttcagctcagtcatttccctgttgaatgaggatcccctgtcccaggt
gaggagccctcagcttgaggagccctcagcttgaggagccagccgctgcctcatcaccct
tctcccttccctctggagtgggtttctctggtcagcctaaagactggtctgcctatccag
GACTTGCCTGTGAAGATGGCTTCAATCTTCAAGAACTTTGTCATTACCTATAACCGGACA
TATGAGTCAAAGGAAG
gtgaggacccagccttggctgtacctgttcctatcagaacaggactttccccccaacttg
gcaccttggtgtgtgggaggagaaagacaagaggcagtgtacctgttcaaggaccccata
attcctgagctctccctaagccttcccagcctggcagccaccctgagtacctggcccctt

 1.05 Intr +   3373   3486  114  2  0  101   91   137 0.892  16.89
ctgggaagtcatcacttcagtttggccctaaaagttgatcagacctcccactccatcact
tgcatgtctggcccccacccctacctgctccccggggaaacccctgcctgctagccccaa
ttgcccttccttttatctgcctggggtcgaacccctcctcttctgctccttggtcctcag
AAGCCCGGTGGCGCCTGTCCGTCTTTGTCAATAACATGGTGCGAGCACAGAAGATCCAGG
CCCTGGACCGTGGCACAGCTCAGTATGGAGTCACCAAGTTCAGTGATCTCACAG
gtagggatagtggccacagtcctcatggatccaggaagagacaggaccttgctcgcaagg
cctctggtcaggtctggcttagaacactcttcctccccatgccctgcccacctttgcccg
cagaggaggagttccgcactatctacctgaatactctcctgaggaaagagcctggcaaca

 1.06 Intr +   3610   3770  161  2  2   94   53   130 0.423  11.00
aggccctggaccgtggcacagctcagtatggagtcaccaagttcagtgatctcacaggta
gggatagtggccacagtcctcatggatccaggaagagacaggaccttgctcgcaaggcct
ctggtcaggtctggcttagaacactcttcctccccatgccctgcccacctttgcccgcag
AGGAGGAGTTCCGCACTATCTACCTGAATACTCTCCTGAGGAAAGAGCCTGGCAACAAGA
TGAAGCAAGCCAAGTCTGTGGGTGACCTCGCCCCACCTGAATGGGACTGGAGGAGTAAGG
GGGCTGTCACAAAAGTCAAAGACCAGGTTGGACCCCTGGAA
gtgagggtgggacatgggcactgcactggggctgacgaaggggcccggctctgactccaa
ctccacccatctcttgtagggcatgtgtggctcctgctgggccttctcagtcacaggcaa
tgtggagggccagtggtttctcaaccaggggaccctgctctccctctctgaacagggtga

 1.07 Intr +   3850   3946   97  0  1  126   84    51 0.999   9.24
tgaagcaagccaagtctgtgggtgacctcgccccacctgaatgggactggaggagtaagg
gggctgtcacaaaagtcaaagaccaggttggacccctggaagtgagggtgggacatgggc
actgcactggggctgacgaaggggcccggctctgactccaactccacccatctcttgtag
GGCATGTGTGGCTCCTGCTGGGCCTTCTCAGTCACAGGCAATGTGGAGGGCCAGTGGTTT
CTCAACCAGGGGACCCTGCTCTCCCTCTCTGAACAGG
gtgagcatctcgctctactcctctgtccccagcctagcccctcaggagggcttcttggga
ccagccttctgtctcctagagctcttggactgtgacaagatggacaaggcctgcatgggc
ggcttgccctccaatgcctactcggccataaagaatttgggtatgcattaatggggtcag

 1.08 Intr +   4026   4106   81  1  0   59   59   120 0.744   6.96
gtagggcatgtgtggctcctgctgggccttctcagtcacaggcaatgtggagggccagtg
gtttctcaaccaggggaccctgctctccctctctgaacagggtgagcatctcgctctact
cctctgtccccagcctagcccctcaggagggcttcttgggaccagccttctgtctcctag
AGCTCTTGGACTGTGACAAGATGGACAAGGCCTGCATGGGCGGCTTGCCCTCCAATGCCT
ACTCGGCCATAAAGAATTTGG
gtatgcattaatggggtcaggaggggcaaccggagccacttctccctgtacaagaagtta
cttcataatgggggggagacatgagcatgagagttacacagaactgggtccaggtcttaa
tgctgacccagccaggcgtggtggctcatgcctgtaattccaacactttgggaggccaac

 1.09 Intr +   4771   4890  120  2  0   94   70   209 0.999  21.34
ccccatctctcccagcctcagatgtgtcatttctagaatgaagacattcttcagagggga
tggcctgtggcctggggtggacgaggaatgtgaaacctcgcgtagagggcttagttcatt
tctggctgtgaatggcaaatgggagcctgcccttctctactcacccccaccgttccccag
GAGGGCTGGAGACAGAGGATGACTACAGCTACCAGGGTCACATGCAGTCCTGCAACTTCT
CAGCAGAGAAGGCCAAGGTCTACATCAATGACTCCGTGGAGCTGAGCCAGAACGAGCAGA

gtgagtgaggggcagggtgaggtgaggtcaggtggggccggggcctgggtgcctactgat
gccaccccttcccatctcagagctggcagcctggctggccaagagaggcccaatctccgt
ggccatcaatgcctttggcatgcaggtgaggccctagccccactgcccctgccccatctc

 1.10 Intr +   4971   5035   65  1  2   96   94    89 0.999   9.88
gactacagctaccagggtcacatgcagtcctgcaacttctcagcagagaaggccaaggtc
tacatcaatgactccgtggagctgagccagaacgagcagagtgagtgaggggcagggtga
ggtgaggtcaggtggggccggggcctgggtgcctactgatgccaccccttcccatctcag
AGCTGGCAGCCTGGCTGGCCAAGAGAGGCCCAATCTCCGTGGCCATCAATGCCTTTGGCA
TGCAG
gtgaggccctagccccactgcccctgccccatctcttgttgacctccccgacctcttctt
ggagtcgatcccctactccttctccacctccagttttaccgccacgggatctcccgccct
ctccggcccctctgcagcccttggctcattgaccatgcggtgttgcttgtgggctacggc

 1.11 Intr +   5129   5219   91  1  1   72   84   117 0.959  10.43
atgccaccccttcccatctcagagctggcagcctggctggccaagagaggcccaatctcc
gtggccatcaatgcctttggcatgcaggtgaggccctagccccactgcccctgccccatc
tcttgttgacctccccgacctcttcttggagtcgatcccctactccttctccacctccag
TTTTACCGCCACGGGATCTCCCGCCCTCTCCGGCCCCTCTGCAGCCCTTGGCTCATTGAC
CATGCGGTGTTGCTTGTGGGCTACGGCAACC
gtgagttccgctgcctgtcctgcatccagccaggccacaggcaggggtgggatcacagca
tctcaggtcctctagaggggaaatagggggaatgcctaggaaccctgtccttacccactg
cctgggccatgaccagctgggcatcatctgtcctctctatggcagggaagctgagctgtg

 1.12 Intr +   5631   5689   59  1  2   63  113    48 0.950   4.54
gcttcctccctgccccagggcttctccctgaggctggtaggtgggcccctcgctttctgc
tcttttcctagtccctgtcacacagtaggcccagtgcaagtatttgaagggtgcaaagtg
attaaggctctgcctggagaattaaggaccctgatccttgcgctctgcactgcaccccag
GCTCTGACGTTCCCTTTTGGGCCATCAAGAACAGCTGGGGCACTGACTGGGGTGAGAAG
gtgagtcttgctggcttggcccctggccctccagccgccatcctaccctggtgccctcac
cagctccccctctcccccagggttactactacttgcatcgtgggtccggggcctgtggcg
tgaacaccatggccagctcggcggtggtggactgaagaggggcccccagctcgggacctg

 1.13 Term +   5770   5844   75  0  0  115   49    93 0.992   6.85
aattaaggaccctgatccttgcgctctgcactgcaccccaggctctgacgttcccttttg
ggccatcaagaacagctggggcactgactggggtgagaaggtgagtcttgctggcttggc
ccctggccctccagccgccatcctaccctggtgccctcaccagctccccctctcccccag
GGTTACTACTACTTGCATCGTGGGTCCGGGGCCTGTGGCGTGAACACCATGGCCAGCTCG
GCGGTGGTGGACTGA
agaggggcccccagctcgggacctggtgctgatcagagtggctgctgccccagcctgaca
tgtgtccaggcccctccccgggaggtacagctggcagagggaaaggcactgggtacctca
gggtgagcagagggcactgggctggggcacagcccctgcttccctgcaccccattcccac

 2.04 PlyA -   6472   6467    6                               1.05
 2.03 Term -   6742   6584  159  1  0   90   46   329 0.992  27.79
 2.02 Intr -   6981   6823  159  0  0   95  113   226 0.999  27.18
 2.01 Init -   7505   7455   51  2  0   70   85   109 0.997  10.05

Predicted peptide sequence(s):


>CTSF_1|GENSCAN_predicted_peptide_1|489_aa
MAPWLQLLSLLGLLPGAVAAPAQPRAASFQAWGPPSPELLAPTRFALEMFNRGRAAGTRA
VLGLVRGRVRRAGQGSLYSLEATLEEPPCNDPMVCRLPVSKKTLLCSFQVLDELGRHVLL
RKDCGPVDTKVPGAGEPKSAFTQGSAMISSLSQNHPDNRNETFSSVISLLNEDPLSQDLP
VKMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGTAQYGVTKFSDLT
EEEFRTIYLNTLLRKEPGNKMKQAKSVGDLAPPEWDWRSKGAVTKVKDQVGPLEGMCGSC
WAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETED
DYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHG
ISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVN
TMASSAVVD

>CTSF_1|GENSCAN_predicted_peptide_2|122_aa
MEPDDFRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTTEQVV
ASFKILAGDKNYITPEELRRELPAKQAEYCIRRMVPYKGSGAPAGALDYVAFSSALYGES
DL