GENSCAN 1.0	Date run: 15-Jan-104	Time: 01:40:35

Sequence CATSPER1_1 : 12160 bp : 56.35% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1433   2157  725  0  2   73   81   335 0.256  23.09
ctcaggaaagaagggaaatccaggcggggcctgttgggcccaggtcttgagctcttttgg
ctccagagttcccagcacagtcatggatcaaaactcagtgcctgaaaaggctcagaatga
ggcagacaccaataacgcagataggttctttcgctctcactcatcacccccacaccacag
GCCAGGCCACAGCAGAGCTCTCCACCATTACGAGTTGCACCATCACGGCGTGCCCCACCA
ACGTGGTGAATCTCACCACCCTCCGGAGTTCCAAGACTTCCACGACCAAGCCTTGTCCTC
CCATGTCCACCAATCTCACCACCACAGCGAGGCACGGAATCACGGCAGAGCCCATGGCCC
CACAGGCTTTGGTCTGGCTCCCTCTCAAGGCGCCGTCCCCTCCCACCGTTCCTACGGTGA
GGACTACCATGATGAGCTCCAACGTGATGGCAGGAGGCATCATGATGGGTCCCAATACGG
TGGGTTCCATCAGCAGAGTGACTCCCATTACCATAGGGGGTCTCACCATGGCAGACCCCA
ATATCTCGGTGAGAATTTATCCCACTATTCCTCTGGCGTGCCCCACCACGGTGAGGCTTC
CCACCATGGTGGGTCCTACCTCCCCCATGGACCCAATCCCTACAGTGAGTCCTTCCACCA
CAGCGAGGCTTCCCACCTTAGCGGGCTCCAACACGATGAGTCCCAGCATCACCAAGTCCC
CCACCGTGGCTGGCCCCACCATCACCAAGTCCACCACCATGGCAGGTCCCGTCATCATGA
AGCCCACCAGCATGGAAAGTCTCCTCATCACGGAGAGACCATTTCCCCTCATTCCTCTGT
GGGGTCCTACCAGCGTGGGATATCTGACTATCACAGCGAGTACCACCAAGGTGATCACCA
CCCCA
gtgagtaccaccatggcgaccatccccaccacacacagcaccactaccaccagacccacc
ggcaccgagactaccatcagcaccaagaccaccacggcgcgtatcattccagttacctcc
atggcgactacgtccagagcacttcccaactctctatcccacacacatcccggagcctga

 1.02 Intr +   2196   2550  355  2  1   21   87   203 0.466   8.92
aggtcccgtcatcatgaagcccaccagcatggaaagtctcctcatcacggagagaccatt
tcccctcattcctctgtggggtcctaccagcgtgggatatctgactatcacagcgagtac
caccaaggtgatcaccaccccagtgagtaccaccatggcgaccatccccaccacacacag
CACCACTACCACCAGACCCACCGGCACCGAGACTACCATCAGCACCAAGACCACCACGGC
GCGTATCATTCCAGTTACCTCCATGGCGACTACGTCCAGAGCACTTCCCAACTCTCTATC
CCACACACATCCCGGAGCCTGATTCACGATGCCCCCGGCCCTGCTGCTTCTCGTACAGGA
GTCTTCCCCTATCACGTAGCACACCCACGGGGCTCGGCTCACAGCATGACTCGGTCCTCC
AGCACAATCCGCTCACGTGTCACCCAGATGTCCAAAAAAGTCCATACCCAGGATATCTCC
ACCAAACATTCAGAAGACTGGGGCAAAGAAGAAGGGCAATTTCAGAAACGCAAAA
gtgagtctttgctgggccccccatgccaactcctgctgcctggcgcaggatccagacctg
atctcggccccgcactgtccttccgcagatcgtaaggcccgaccctcctgcacaggtccc
ccactggctattcactctcctgactgttcatggtcccatcttttattccttgaattatgt

 1.03 Intr +   4653   4865  213  1  0  102   95   343 0.990  35.61
ggcaggcacctgcagtcccagctacttgggaggctgaggcacaagagttgcttgaacccg
ggaggcagagggccagcaagcaggcaggagtgaccatggacgctgagccaggctgggggg
tgcctgggacctcgtgtcccctcttgcacacacttgactttctggccctgttcctttcag
CCGGCCGGCTCCAGCGGACCCGCAAGAAGGGACACTCTACCAATCTCTTCCAGTGGCTGT
GGGAAAAGCTAACCTTCCTCATTCAGGGCTTCCGGGAAATGATCCGGAACCTGACCCAAT
CCTTGGCCTTTGAAACTTTCATCTTCTTCGTTGTCTGCCTCAACACCGTCATGCTGGTGG
CCCAGACCTTCGCTGAAGTCGAGATCCGGGGCG
gtaagagccagggagtcctgttcccatggagaagccaccgatgctcttccaggacctccg
tgggcctgatccagtgccgggcggtttataggactcagctcacttgatcctcacccctgg
gaagtagatggccttacccagtattagagagcgtctcagaaagaccccgctgaggccggc

 1.04 Intr +   5835   5948  114  1  0   99   55   243 0.999  23.02
acacaattatccccattttaaagacaagaaaactgagacacagcagtagtgaagtcgcgc
agctgcttacgcagagccggggagagcctgggaatctgggcttgtgtgaggctaatgctg
aggagagagagggcactgggtgctggggacagctctgagtgcacccctgtgttcctgcag
AGTGGTACTTCATGGCCTTGGACTCCATATTCTTCTGCATCTACGTGGTGGAAGCCCTGC
TCAAGATCATCGCCCTGGGCCTCTCGTACTTCTTTGACTTCTGGAACAATTTGG
gtgggtgcggccggggccaggctgcgtgtgtttagtctgggggaggctcgggacgagaga
aggatggggaagggggcgctggcgttgggagcccgccaggctcaggcaccccgtgccctc
agacttcttcattatggccatggccgtgctggacttcttgctgatgcagacccactcctt

 1.05 Intr +   6071   6218  148  0  1   55   82   295 0.999  25.40
ctgctcaagatcatcgccctgggcctctcgtacttctttgacttctggaacaatttgggt
gggtgcggccggggccaggctgcgtgtgtttagtctgggggaggctcgggacgagagaag
gatggggaagggggcgctggcgttgggagcccgccaggctcaggcaccccgtgccctcag
ACTTCTTCATTATGGCCATGGCCGTGCTGGACTTCTTGCTGATGCAGACCCACTCCTTCG
CCATCTACCACCAAAGCCTCTTCCGGATCCTCAAGGTCTTCAAGAGCCTGCGGGCCCTGA
GGGCAATCCGGGTCCTGCGGAGGCTCAG
gtcagtggccacggctcccacctggggtggggactccaaaggaagaggggacacagacca
gggccccaaagaaatccactgtgacctgctcaagggatgggggcgcaggaggctgctgac
cccagcctgcttctgccttctgtcatgcactggaatcagccccttcatttttccagagag

 1.06 Intr +   6529   6628  100  1  1  129   13   112 0.996   8.41
ttctgccttctgtcatgcactggaatcagccccttcatttttccagagaggggccaggac
tcacccaagtcaccaacaagtcaggagcctcctgccttcagcgccagctgtggctgctgg
gcagagacacacacccccgcccctcaccgatgactcagtccccactccttctgcccacag
CTTCCTGACCAGCGTCCAGGAAGTGACAGGGACCCTGGGCCAGTCCTTGCCGTCCATCGC
AGCCATCCTCATCCTCATGTTTACCTGCCTCTGTATCCTG
gtgctgcaggggctggggtgggggcctgaggggctgcggtgaaaggggtgcggggagcag
ggatggggcaggacgaggggcgctggggtggggatagcactggagagctgagtttggccc
tgaacagccagtcctcttctccgcggtcctccgggcactgttccgcaaatctgaccccaa

 1.07 Intr +   6756   6903  148  2  1  -16   49   290 0.580  15.02
tgccgtccatcgcagccatcctcatcctcatgtttacctgcctctgtatcctggtgctgc
aggggctggggtgggggcctgaggggctgcggtgaaaggggtgcggggagcagggatggg
gcaggacgaggggcgctggggtggggatagcactggagagctgagtttggccctgaacag
CCAGTCCTCTTCTCCGCGGTCCTCCGGGCACTGTTCCGCAAATCTGACCCCAAGCGCTTC
CAGAACATCTTCACCACCATCTTCACCCTCTTCACCTTGCTCACGCTGGATGACTGGTCC
CTCATCTACATGGACAGCCGTGCCCAGG
gtagggcaggccccaggctgcagggagggccggggattggcggggtggaccggccagggc
tcagtgaccccatcggcaaagtggggcttctgatgcctgcatgtccgggtatgggaaggg
agcaggtcgtggttgggggtggcgagcacagcctgactgtgccctctggcctgctccccc

 1.08 Intr +   7087   7150   64  2  1  126   61   120 0.936  11.37
gggcaggccccaggctgcagggagggccggggattggcggggtggaccggccagggctca
gtgaccccatcggcaaagtggggcttctgatgcctgcatgtccgggtatgggaagggagc
aggtcgtggttgggggtggcgagcacagcctgactgtgccctctggcctgctccccctag
GCGCCTGGTACATCATTCCCATCCTCGTAATTTACATCATCATCCAGTACTTCATCTTCC
TCAA
gtgaggactcacccctgctctgctgcccagcaccacccacacttcctcctctcccctggg
acccttaccccagccctctcaccctggtcatgccacgctgaacccacaagaagtaccggg
tgcccctctcctctggcctcctcgctgagggcacacccctgtccctctccccagcctggt

 1.09 Intr +   7325   7397   73  2  1  100   71    98 0.927   9.20
cctcaagtgaggactcacccctgctctgctgcccagcaccacccacacttcctcctctcc
cctgggacccttaccccagccctctcaccctggtcatgccacgctgaacccacaagaagt
accgggtgcccctctcctctggcctcctcgctgagggcacacccctgtccctctccccag
CCTGGTGATTACTGTCCTGGTGGATAGCTTCCAGACGGCGCTGTTCAAAGGCCTTGAGAA
AGCGAAGCAGGAG
gtaccgagtggggtgggacaggtggaccagatcaggaagctggaggagtgaggccagggg
cctccagggttgagcaggcctgggactctggcagatctgaggcctcttcttcccagaggg
ccgcccggatccaagagaagctgctggaagactcactgacggagctcagagctgcaggta

 1.10 Intr +   7514   7574   61  1  1   57   80    82 0.965   3.10
tactgtcctggtggatagcttccagacggcgctgttcaaaggccttgagaaagcgaagca
ggaggtaccgagtggggtgggacaggtggaccagatcaggaagctggaggagtgaggcca
ggggcctccagggttgagcaggcctgggactctggcagatctgaggcctcttcttcccag
AGGGCCGCCCGGATCCAAGAGAAGCTGCTGGAAGACTCACTGACGGAGCTCAGAGCTGCA
G
gtatgggcctggcccgccctggccccacctgcccgtccgcagtgggggccagtctctcca
tccccctaacctccttccacagtcacagaattccagactcagttttagagttttagaatt
tgagactcaggaggactttagtccagaggaccctagaacaatcctcccaaagccagttaa

 1.11 Intr +   8812   8887   76  2  1  104   53   152 0.852  12.37
tggggtgggtgctagacgggcaaacaaagggaactgcatcgtgctgcatgcccggagaag
caacctcctggagcagcctggccagaaactccattagcccttatcttcctgacacatggg
gttcctctgcctcctctccaaatccaggccttgacctcacccttctttctctacatccag
AGCCCAAAGAGGTGGCGAGTGAAGGCACCATGCTGAAGCGGCTCATCGAGAAAAAGTTTG
GGACCATGACTGAGAA
gtgaggagacaggaagggagcgaggcctggggtctgagggtgaggcctgggggcctggct
ggagggctggagggaaagggacattgcctgcccctctagaaggggatggagcgctgaggc
ttgtggatgagcctgtgggtgcaacgaggagaccctgggtggcttctgcacatccagagg

 1.12 Intr +  10540  10654  115  1  1  106   51   247 0.964  23.75
gacttgggctctttctcatatctggaaaaggagacctcctggaaatgcaggtctgcagtc
atataaattttgtggggaggaggcaggcaagaagagcctctgggtggttctggggtgcag
taggcccagccagcaggtcagcccagcccctgtctctgcgacccccccgcccacccgcag
GCAGCAGGAGCTCCTGTTCCATTACCTGCAGCTGGTGGCAAGCGTGGAGCAGGAGCAGCA
GAAGTTCCGCTCCCAGGCAGCCGTCATCGATGAGATTGTGGACACCACATTTGAG
gtgaaccaggcaggagcgggaaggggccggcgaggggaaccccaggggcttgtagccaga
aatggctccaagtaactcccatggggatcggggaaggcaaagtctggctcattcacccac
cagtgccccactcacccctgcaggctggagaagaggacttcaggaattgaccccaggagg

Predicted peptide sequence(s):


>CATSPER1_1|GENSCAN_predicted_peptide_1|731_aa
XQATAELSTITSCTITACPTNVVNLTTLRSSKTSTTKPCPPMSTNLTTTARHGITAEPMA
PQALVWLPLKAPSPPTVPTVRTTMMSSNVMAGGIMMGPNTVGSISRVTPITIGGLTMADP
NISVRIYPTIPLACPTTVRLPTMVGPTSPMDPIPTVSPSTTARLPTLAGSNTMSPSITKS
PTVAGPTITKSTTMAGPVIMKPTSMESLLITERPFPLIPLWGPTSVGYLTITASTTKVIT
TPHHYHQTHRHRDYHQHQDHHGAYHSSYLHGDYVQSTSQLSIPHTSRSLIHDAPGPAASR
TGVFPYHVAHPRGSAHSMTRSSSTIRSRVTQMSKKVHTQDISTKHSEDWGKEEGQFQKRK
TGRLQRTRKKGHSTNLFQWLWEKLTFLIQGFREMIRNLTQSLAFETFIFFVVCLNTVMLV
AQTFAEVEIRGEWYFMALDSIFFCIYVVEALLKIIALGLSYFFDFWNNLDFFIMAMAVLD
FLLMQTHSFAIYHQSLFRILKVFKSLRALRAIRVLRRLSFLTSVQEVTGTLGQSLPSIAA
ILILMFTCLCILPVLFSAVLRALFRKSDPKRFQNIFTTIFTLFTLLTLDDWSLIYMDSRA
QGAWYIIPILVIYIIIQYFIFLNLVITVLVDSFQTALFKGLEKAKQERAARIQEKLLEDS
LTELRAAEPKEVASEGTMLKRLIEKKFGTMTEKQQELLFHYLQLVASVEQEQQKFRSQAA
VIDEIVDTTFE