GENSCAN 1.0	Date run: 15-Jan-104	Time: 00:34:32

Sequence CASP4_1 : 28098 bp : 37.80% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    199    314  116  0  2   92   47    93 0.335   5.58
caaagagtgctgcctcctccttcctccggaagcttcttcccagaggatcactgacctgac
gcctgttggaactctcctgtatgaggtgtctggcaacccctgttgaatggtctaacccag
tcaggaggcccaggatcaggaactcacttaaggaaagagtctggctatcccttagcagag
ATGGTGCACTGGGCTGGGGGAATCCCCCTTGTCTGGATCGCTGATACTCTTCAGAGCCAG
CAGGCAGGAAAGATTAAGTTGGCTGAACCTGAGACCGCAGCTGCCCCTCTCCGCAG
gtgctctgtaccagggaaatgagagctctgtctgtaaactctaggtggagttgctgaaat
tcctgcaagcatttcttgccgggagaggagggatggatcccggtcccacctaaagaagca
gtctggccatgatctgccacagcggctgtgctgcactgtgaagactgctgcccagtccaa

 1.02 Intr +   5001   5097   97  0  1   62   86    79 0.264   4.19
tatttgcatgaagtgcaacaagaataattattttttatttaggctgttttttgtttaaat
tggctttgatggaactctgttccatgaggaatctcagataagactttttaagagccaatc
ccagccatgcatttgtacccttaaatacctatgagttgggtaaattcctctcctctcaag
GTCCCAAGATAACTTGGAGCTCATGAACCTGTTAGAAAGTGATATTCTTTACTTACTACA
GATCAAGAACCTTGTACAAGGACTCTGTGTAGACAAG
gtatgaagccagattccccaaggggcttttattggctctgtaagtcaacttcgattcttt
aagggaagagtgccattccagtcaaagccttggtaaaataaccaatttctccaattgtgt
catgttacaaaagaaaacagatttttattgtgcttatggaattaaccatgctgccataaa

 1.03 Intr +   8290   8684  395  0  2  -12   68   237 0.092   4.23
agaaatctcaaaattgtcctgattgaggacaagtctcgtgaaccaagactcttcctacta
gttagagccaaccaagaccccagtggagccgaacagataccccgtggtggagctacaaac
agacaccctgcaatggggctacagacaccctgcaatggggctacagacaccccatcatag
AGCTACAGACAAGTCGAGAGAAGGAAGGAGGCATTAGCAGTGCCTAGTAGATTCACCAAT
CCTAACACCCTGCAATGGGGCTACAGACAGACACCCCACTATGGGGCCACAGAACCAGTC
AGGAGAAGGAAGGAGGCATTGGCAGCACCTAGGATACTCACCAATCCAGACACCCTTCAA
TGCAGCTACAGACGGAAACCCTGTGATAGGGCCACAGTTAGAGGACATCTCTCCAGGATT
ATTTCTCCGTTGCAATTAAATGCATGCACATTGGGTTGGCAGTGCCTGCCAGTGGAGAGA
GTACCAGAGCCAGCCCCCAGTCCAAGAGAACTAGGCGGCTACTTGGGCTACCTTCTGGAT
CCATCGCTGGAGCGGGGGCACCAAACCACAAGCAG
gtagccacaaaggctttcccagtctgatttcgttcattgttgtaatttcctcagttataa
ttttgcaaaggtggtttcatattccttaagagttgagccacacataagttttattcattt
gttcctacatggacttgactactgattcagtaaataattagtaaatattcagtaaataac

 1.04 Intr +  14779  15020  242  1  2  -44  116   200 0.181   5.87
acctggtaggaatatgatgaatgacagaactctataggtacaagaagacagatggtgaag
taggacatactttcagaagtatttcacattatagaactatatctaaagtgagggtgaaac
tctttaagctgtgcccatagttaaaggaatctttctatttctaacagaaggcaaccacag
AAAAAAGCCACTTAAGGTGTTGGAATCCCTGGGCAAAGATTTCCTCACTGGTGTTTTGGA
TAACTTGGTGGAACAAAATGTACTGAACTGGAAGGAAGAGGAAAAAAAGAAATATTACGA
TGCTAAAACTGAAGACAAAGTTCGGGTCATGGCAGACTCTATGCAAGAGAAGCAACGTAT
GGCAGGACAAATGCTTCTTCAAACCTTTTTTAACATAGACCAAATATCCCCCAATAAAAA
AG
gtaagactggattttttacaatgaatgtctcaattttccctaaatctgtttaactccaag
gcctaagcagtgtcttctgtgattcccctatctttcccttcctaaactatcattttcact
aaacctatctttgtccttttagagaccacttcccttttgtggggtggaatccagtttaca

 1.05 Intr +  17762  17871  110  0  2   54   33    97 0.778  -0.12
gcttttctatcttttccagtaacaatacatctcctgatgtagaatactagatatgagata
caactaaaacccctatatgtgaagaaatcttcccaggacgtcttctctctcgatcttctt
aggtgataaattgggtcacagaggcagaaatcacaatttatgttctgcaatatcctgcag
CTCATCCGAATATGGAGGCTGGACCACCTGAGTCAGGAGAATCTACAGATGCCCTCAAGC
TTTGTCCTCATGAAGAATTCCTGAGACTATGTAAAGAAAGAGCTGAAGAG
gtgctatgctatctatatgaaatagaaaaaaaagaagagatatcattgctttccttcagt
gcaccatttcttacagcactaaatgattgggggtggggatgacagtaaccattttcaata
atgcttttactaagggaaagattatgtgacttcacaatgataccaatcctttctcaatcc

 1.06 Intr +  18669  18842  174  2  0   99   90   149 0.999  15.41
aatttcagatatgtccggttctttccctgggttcttgagagagagaaagtcagtgtcttt
tgatacaagttagagcagagaggagctgcatgaagacttgaaaaagcaacactgataggc
ataaggaggctgaaaggagacttgagtaaattaaatttattgcatctccatatcctgcag
ATCTATCCAATAAAGGAGAGAAACAACCGCACACGCCTGGCTCTCATCATATGCAATACA
GAGTTTGACCATCTGCCTCCGAGGAATGGAGCTGACTTTGACATCACAGGGATGAAGGAG
CTACTTGAGGGTCTGGACTATAGTGTAGATGTAGAAGAGAATCTGACAGCCAGG
gtaagaatccctcagccgccacaaacacatacatattcaagacacatccttctaataact
acctagcttcaaagagctcaacaaggtttaacaacctttgggtgtgtgtgtgtgtgtgtg
tgtgtgtatacaaaataagagtactagactggtaaatctatgtctctttggtcctccaaa

 1.07 Intr +  19990  20224  235  0  1  104   89   267 0.972  24.74
cacggccccataaagaaggaaaaataaaaccattaaacagctgtcatgactgagtaagca
ctaagtgaagcaccacgacctggatgttacatatgtttcttgtttcgctcatggtaaatc
taggagtcccctttaattgtgatgcttctctgactgaagttagacattgctcttttacag
GATATGGAGTCAGCGCTGAGGGCATTTGCTACCAGACCAGAGCACAAGTCCTCTGACAGC
ACATTCTTGGTACTCATGTCTCATGGCATCCTGGAGGGAATCTGCGGAACTGTGCATGAT
GAGAAAAAACCAGATGTGCTGCTTTATGACACCATCTTCCAGATATTCAACAACCGCAAC
TGCCTCAGTCTGAAGGACAAACCCAAGGTCATCATTGTCCAGGCCTGCAGAGGTG
gtgagtgctgagactgaacatctaacagttatgaaggtgtatgcagaggattgtgatgtt
tggtttatatttaggggcaacattcttaaacctcatccagtgtaaataaagtacattgaa
ttctaaagaaactctacctaagggtctggtataacaagaaattgtctcatcaaaattagt

 1.08 Intr +  21091  21234  144  2  0    4   60   147 0.695   2.83
ctggagagaaagaaaagtggtgtgtgtgtgtgtgtgtctctctctgtgtgtgtttgtatg
tgtgtgggtctgtatgtatgaaactagtaagaatgaacattcaaaaagaacaaggtgggc
aactgtgacagccattctgtgggaggcacagcagtgtgcagaaagttaatgtctccatag
CAAACCGTGGGGAACTGTGGGTCAGAGACTCTCCAGCATCCTTGGAAGTGGCCTCTTCAC
AGTCATCTGAGAACCTAGAGGAAGATGCTGTTTACAAGACCCACGTGGAGAAGGACTTCA
TTGCTTTCTGCTCTTCAACGCCAC
gtatgtatctttcagtggcagtaagggatttgtgggcctgaggccatctttgaatgaatc
tagaaaatcaagaatccctatgaaacaatgatctgatagaatgttgtgtgctctccacat
attttacatgatcttatgtgtgccgtgagaacagattcctaaagcaacccgatacatgga

 1.09 Intr +  22643  22684   42  0  0   60  115    41 0.203   1.29
aagataattcccaagctatgcttttctttttaaaaacattctcaaaacaaaaatatgaac
aaaaacatagtgaaagtcatagcccaaggcatacccatctgtatcattatagacaacgtg
tcctggagagacagcacaatgggctctatcttcatcacacaactcatcacatgcttccag
AAATATTCTTGGTGCTGCCACCTAGAGGAAGTATTTCGGAAG
gtaagtgtctcttttctagttactcatttatttcttcaggaagaatttgtcatgattcac
tttttacttcacaatgacaatttttgtcagggaagtgaaagtagagaggtacccagtttc
tgtcattcagttgtttaaaatatggctaaggaaaagacaattccaatatatcccagcaga

 1.10 Term +  26794  26822   29  2  2  146   37    16 0.163  -0.44
gctttaaattaggttttacaaagatcacattttggtgaatagactaagatgtcacagatg
gaagtcaagggaagtggcaagagcacatggaagaggatgcaagaagaatcatgatgaggg
atgggatgaaggcagcaaggggtaaccatcttgaccttctgttttttctctcccctgcag
GAAGCCACAAGCAGCCCAGCCCTCCTTAA
tcaacttcaaggagcaccttcattagtacagcttgcatatttaacattttgtatttcaat
aaaagtgaagacaaacgaactgtgtctttttctaatagagaatataatctcaatgaaaat
ggtgggtgagtggaaatgaagtggaggaagctaactggattttcgagctttatggctcat

Predicted peptide sequence(s):


>CASP4_1|GENSCAN_predicted_peptide_1|527_aa
MVHWAGGIPLVWIADTLQSQQAGKIKLAEPETAAAPLRRSQDNLELMNLLESDILYLLQI
KNLVQGLCVDKSYRQVERRKEALAVPSRFTNPNTLQWGYRQTPHYGATEPVRRRKEALAA
PRILTNPDTLQCSYRRKPCDRATVRGHLSRIISPLQLNACTLGWQCLPVERVPEPAPSPR
ELGGYLGYLLDPSLERGHQTTSRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKK
YYDAKTEDKVRVMADSMQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTD
ALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKE
LLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEK
KPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSE
NLEEDAVYKTHVEKDFIAFCSSTPQIFLVLPPRGSISEGSHKQPSPP