GENSCAN 1.0	Date run: 15-Jan-104	Time: 02:07:12

Sequence CAPN5_1 : 59589 bp : 56.14% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1075   1286  212  0  2   54   74   240 0.941  15.44
ccgagccggtagaggcggtgggtgccgctaggggccccaagtccgcgttcaacacagggg
ctggaatgagaccgctcctctgagcggccgcccaccgcaccagtgcgcatgggcgcaccc
ggccaccgggccgcccaccccgccccacgggagaccacgcctccggctcgcaacgggcaa
ATGGGCGGAGGCCGCGGGCGGGGCGGGGCGGAGCCGGGCCCAGCTGGCCGAACCCGGGGA
ATGCGAGCGCCAGCCCCCGCCGCAGGCCAGTCCCAGCTGGATCTCCGGCCAGAGCCCGAG
GCTGCTGCGCCGGGCGGCTGCAGCCTCCGCTCCAGCGCCCGCGCCGTGCCCTGCATCCCG
GGAGCCCGGCTGGACCCGCGGCGGCTCGGCCG
gtaggaggcgggcggagggaggcgtgtgcttctgtgtgtgtgtgtgtgtgtgtttcgggg
gggtgtgtgcgggtgcagcgcgggccagtgattgctccgggaccacgaatcagtggaggg
ggctgcacctcccgcgggcccggggggaaaggaagtgagcgctggctggggggcggggtc

 1.02 Intr +   4426   4522   97  1  1   96   52    19 0.251  -0.39
tggatggggaagctgtggatgatgtgtgcttacccgcaagggcctgggttactgctcccc
attctggttgtttgcacgtgtgcttccagggacccaagttttcccagggataggggtctg
ggtgggcaacagctgaggctgcggtggcctgtgggtgtgtgctgtggttttctcccacag
TGGGCATGCAAGAGAAGGGGCTGGTGACCAGAGCACATCAAAGCCCATCCACTGGTCCCC
AGCTGCCCTTCACTGTCAGGATGTGCCCCCGGGGATG
gtgggcagaaggctgggagcccattggcttgacccacctgccctgcccagccagcccctg
ctcagccagtgccccctgctgctgtgtaacttctgccagttggagtgaggtgggacccaa
gtgatttgttactcatagcaggaactaagaaactgatgtggggtgactgttgtacagcgg

 1.03 Intr +   5641   5740  100  0  1   40   84    47 0.121  -0.32
tgcagcctgagcccctggtagccagagttcagggatgtttggaagaagggcatccctggc
acagccgcatgggtggtccccaatgtctggaccctgcctgcctttgacagcgtgctgggc
ctttcagggtggagtgcagctcatttcagacattcacgcaataagcccagtgctttgcag
GGTCATTTGATGCTCACCATCACCCTACAAGGGGGTGGGGCTGGGGAGTCCCGCTTTACA
GGTGAGAATACCAAGGCCTATTACGGCCAAGTCCTGTCTG
gtatgtggggtcaggtgaacaggctgggccagtagagcagaaaatacctttattttacag
atgagaattctgaagcacaaagaggttaactgctttgcacctcgctggcctcagtctccc
catctgaggacgggtatgtggacaggatgttgcccagcctgacatcttggggctctggtt

 1.04 Intr +   7257   7328   72  1  0   17   75    89 0.108   0.37
aatcacgagagcctgtggccagagagggcaggagctttcctgggctcacacagcacagtg
aggcagaggtggcttcagtgacctgatcaagtcccattttgttaggttgtctctccggtg
gggagtgagcgagcacacagcccccaccccaccccgggtgagagagaatgtcctgcacag
GGACGCCCAGCTGTATCTACCTGCTGTCAGCACTTTCTCTGCAGGACCTGGTGCTGGACT
GGGAGCCCCGAG
gtagggtggccaccgcactgggttgcctgggactgtgggtttcctggatgtggttctttc
agtgttaaaactgtggtgagctgctcacccgaggcttggcctggggctgccccctgccca
acagtctccacctccacaagtgtggccaggtccttgacttcttcctgtcctgcccaaggc

 1.05 Term +   8522   8778  257  0  2   88   36   103 0.559   1.18
cagccaccaaatggagtttctgccctttctagtcccctctggcttctggccttccctgca
atggctcaagccagggctcttccagtcctgggtcactgcatcagcatctgacctttagtc
ttgcccctggctcccctgtgccccagtaaatgctgatgcccctctgcctggcatccccag
CCCTGCAGAGCTGGTTCTGCCAGCTTCCCCCCAGGCTCCGCCCACCCAGTGCCCTCCCAC
CTTTTCCCTCTCCCTGTGCCACATTGTACCCTGCTGTGCCCTTGCTGCTTCTGGCCTATC
CTTCTGGCCCTGCTCGGGCTCCATCTCGGAAGGCCACCACCATTCACCCCCAGCCCCCTC
CTCATCAGCCAGCTCAGCGCCAGCCCAAATCGGGCACCAGCAAAGATGTGCAAGTTGGAG
TTGACTGTGTCCCCTAA
atgatgaagccccagctgttcagccctcccctgttcatatggcaaaaggtggtggtgggg
ggtgtcttcccttaagaggggagaagaggttgaggaagggaggtaggggaaagggggctt
tgattggcagggaatgggtgagggtgtcactggctccttcggccggcactgggtgatact

 2.01 Init +  18959  19010   52  1  1   76   65    48 0.499   1.22
cggtgtgggccaggcctgagctctgtgtggcctgtgggcctggtatcgcctctgagcttc
agaaacgagagaatccagtctatggagtcaggccggtcggtgtctgtcccactctgctgt
ataccagctgtgtgaccttgggtaggctccacgcctcgctgagccttccgtgcctgtgcc
ATGGGGCTGATGATGTCCGCTTCACAGGGCACATCAGGGACCCAGGGACTCT
gtgagtgaccgtcttcttgccttcctgtccaggtgttccccctcccctccctggggcagc
agccaccatgttctcgtgtgtgaagccctatgaggaccagaactactcagccctgaggcg
ggactgccggcgcaggaaggtgctcttcgaggaccccctcttccccgccactgacgactc

 2.02 Intr +  19043  19242  200  0  2  118   86   135 0.531  15.89
gagtcaggccggtcggtgtctgtcccactctgctgtataccagctgtgtgaccttgggta
ggctccacgcctcgctgagccttccgtgcctgtgccatggggctgatgatgtccgcttca
cagggcacatcagggacccagggactctgtgagtgaccgtcttcttgccttcctgtccag
GTGTTCCCCCTCCCCTCCCTGGGGCAGCAGCCACCATGTTCTCGTGTGTGAAGCCCTATG
AGGACCAGAACTACTCAGCCCTGAGGCGGGACTGCCGGCGCAGGAAGGTGCTCTTCGAGG
ACCCCCTCTTCCCCGCCACTGACGACTCACTCTACTATAAGGGCACGCCGGGGCCCGCCG
TCAGGTGGAAGCGACCCAAG
gtcagtgtctggtcccagctggagctgggtgagcgggcccaggcccacccacaaggctgg
gcctgcagggacatcggggtggtgggaggaggcatccctggccccaggctgctgagaaag
tgagggtgctgaaacggtgggatttgatccggatggggagcttggagaatgggctgtaat

 2.03 Intr +  19787  19903  117  1  0   24   50    95 0.346   0.47
aatttactttcctgattgttatcatcatgattttgaaatagtcatttgtggtagaaatga
aaagtatttattatgatgattaatcaataataataataattgtaaaaagatagtagtacc
tacctcatagagtggttgtgagaattaaaagaggtaatgcatgcaaaattccactcacag
CCTGGCAGCCAGTACGGGACCATGGATACTGATAATGATGAACAGGTGGCGTCTCTCCGA
CCACTCCTTTTGGTCCCTGAGGCTAGAGTGTGTTACACAGAAATGTTTGGCCTCCTG
gtgtgatttcatccccttgaaccccgattcctgggtgtgagggtgggctggggaggggtt
cgctgcttgtctgtgggtcctgcagaatggggtccctggtggcctgggtggaggggaggc
tgcaggaggttactctccctggcctccagggctgtgctagtgacactgagggtcgtcccc

 2.04 Intr +  22107  22252  146  2  2   94   70    40 0.516   2.39
caggtgacaaactggttcccctctcttgctcgtcttctccttggcaactttttgttgggg
acctagagccaccttggttgggacatcccatctcctattgactctgcaggtgggaccagg
ccttgtcctcttgggtgccgacctgggcacctgccttcagcccacacccttcacccacag
GCTCGCTATGTTTTTGTTCTTTCCAGTACAGTGGCCATTCGCTGGCCCCTCACAGGCCTG
GCTGGGGAGATGCACGGAGAATGGAGAATGTCCCCAGGCCTGGGAGCTCAGGGTGTCCGT
CCTCCTCGCTCAGGGCCCGGGACCTG
gtaggcggcctcctgtcaccctgtgggggcaacatcccctcatccagcatgctgtctctc
ccacatctgggtatgagcctggaggtcctttggtggaatgcacaggggacaaggtggggt
gggggagggggactaatgaacagacactggttttggaacctgcagaattcccctagtgca

 2.05 Intr +  24327  24366   40  0  1  103   50    35 0.522  -0.09
tcatttcacctcttcttgtgtggccctgggcaagtgacttaacctttctgtgccttggtt
tcctcatccgtaaaaaggggatgccaacagtgcccatctcacagggttgttttgcacagt
gcctgccacatagcaggtgcccagtcattgtgagatatttctattattgttcctttacag
GTGCCCCAAGGTGGCCCCTGGATTCCAGAGCAGACTCCAG
gtgccaccaacctcaggtggtttctgttggttagagctggtgaccctgagcctctcctgg
cagtgggaacatgcctggctgccttccgctctgtctgctccttcccaggctgcacgattg
cccccaggttcctgctctgccacagcaagtcagggtgatggaatctgggaatcgtgactc

 2.06 Intr +  25458  25646  189  2  0  113   22    55 0.581   1.70
ctagccctttctctgaccctctaaaactctggttcttccgggcagaggggacagcagggt
ccccatcttggtgggaactaggagccctcttccccattctcccttgcaactgctctgctc
cacgatctgtagagtccctacacagccctgctgggatgaccatttatctcctctgcacag
GTGAGGCCCAAAGTTGCACAGCAGGGAGCAGACATTCAAATTCGGTCTTCCTGCCTCTGC
CACCCTCTGCTGGCCGCCTGTGGTAGGACCGCAGAAGCTCTTGGGATGGAACTAGCTCAG
GAGCGCCTGCTGGAGTGGAGGCAGGCAGAGGGCTGCTGCCATCTGCCCATGCTGTGTGGC
GGGGACATG
gtattacacctccctgggcctcagtttccttatctgtaaaaggggatattgcccacttct
cagtgccttggtgaggatggattgtggtgtcagcaggatgcctggtacatgaaaggcatg
tctcagtgtttgcctgtccccaccctccaccatacccacagccactggggagcagtggct

 2.07 Intr +  27873  28004  132  2  0  153  100   175 0.991  26.55
agcggggagcagatgggccctatggggccccaagtctgtggtgggaggcaggtgaatcac
catgctgatgatcacacagcaagtctgtgtctgtcacgtctgtgtctgtcatgtctcctg
ccatggggggcatccgcatgctcctccgcccctcacgctctctcctcgccttctccgcag
GGCATCTGCGAGGACCCCCGCCTCTTTGTGGATGGCATCAGCTCCCACGACCTGCACCAG
GGCCAGGTGGGCAACTGCTGGTTTGTGGCAGCCTGCTCGTCACTTGCCTCCCGGGAGTCG
CTGTGGCAAAAG
gtgaggcctcgggcagagtgggcagggtgctggggagtgtgaacgcagcctgtggccctc
actgccagacaggcggaacctgattgtggcagatgagactttcaaaagcctgtgccaggg
atggggtgggggcccccagtactggccgagcgtcggaattgccatccctcacccttcagc

 2.08 Intr +  28426  28514   89  0  2   50   35    64 0.163  -3.43
cccccccaacactgttggggacacttggcagattaatacacacctgtgaaatgtggaagc
tgtgtgcatcacatttagtgtgcagacaccactgatggggctcaggagacccctgacaga
cacagacctgctgtgtgactcagctggttgctgtcctcctctgggcctgacttttcccag
TTGTTCAGCAAGGGTGGTTTGGTGATCCCCAGCTTCATGACTCCCAGTTCCAAGCTGCTG
GTGTTCTGGACCAGGGCCAAAGGGTTTGG
gtgggaaagaatgggctctggtcctgcaacccaacctcctatcccagcacagttccaagc
tgctggtgttctggaccagggccaaagggtttgggttggaaagaataggctctggtcctg
caacccaacctcctatcccagcacttggcagcagggccttagattccgtgcacaggaggc

 2.09 Term +  36982  37522  541  1  1   76   48  1071 0.187  96.03
tgcattatcgcttctgcggggactggagtggaggcagatggggactcccacccctgacac
acaccccattttgagaactgagtggggctgggaagagccagtggcaaagggaggggaaga
gggaagggcagaaagtaggtggggcccccctttggtggcctcttctctccacggccccag
GCTCCAGCCCACTTGGGTCCTTGGCGTTGGTGGCAGCAGCACTTGGGCCATGGCGGAGGA
CAGGCCGCAGCAGCCGCAGCTGGACATGCCGCTGGTCCTGGACCAGGGCCTGACCAGGCA
GATGCGGCTACGCGTGGAGAGCCTGAAGCAGCGCGGGGAGAAGCGCCAGGATGGGGAGAA
GCTGCTGCAGCCAGCGGAGTCTGTGTACCGCCTCAACTTCACCCAGCAGCAGCGGCTACA
GTTCGAGCGCTGGAATGTCGTGCTGGACAAGCCGGGCAAGGTCACCATCACAGGCACCTC
GCAGAACTGGACGCCTGACCTCACCAACCTCATGACACGCCAGCTGCTGGACCCCACTGC
CATCTTCTGGCGCAAGGAGGACTCGGATGCCATAGATTGGAATGAGGCCGACGCCCTGGA
GTTTGGGGAGCGCCTGTCGGACCTGGCCAAGATCCGCAAGGTCATGTACTTCCTCGTCAC
CTTTGGCGAGGGTGTGGAGCCCGCCAACCTCAAGGCCTCCGTGGTTTTTAACCAGCTCTG
A
cagcagctgccagctgctgctctcctctagcccacctgtgctctcccctgcccctgccac
tttcccccctgtatttttggggccattattctcgctgctcagcctgtcctctgcttgccc
agaggccccctgagtcccacacctttcctcctctgcttctccctggggccagcactccag

 3.01 Init +  44120  44170   51  1  0  102   59   -16 0.411  -1.99
ggggcggtgaagcaggaggggaaatggaggcccttggggatcccagactctgggtctcca
ggccctggagcctcattagcagcttcttgagccacagagggctcagagccaagcctcgag
tttgactaatgatcctcccgaggtcctagcagcctgtgagggctgcccttcctcccagcc
ATGGAGTCCAGAGCATTCAGAACAGGGCAGGAGCAGAAGGAGGGGGTGAAG
gtgatgggccaggcctgtgttctcagcttaggactccctgtcactctgtgcgcttgggca
gatcttgtttctttctggacctcagtcttcccatttgtgcagtgggaatggtaaccctca
ccttgtatggaaccgctcttttttttttttttgagacagagtcttgctctgttgcccagc

 3.02 Intr +  45894  45962   69  2  0   63  115    17 0.732   1.77
cacaggcatttcccagatgcgtcataagtaataaaatcaatgtctcagtgtccccagtca
atgtctttgaattcattcattcagtcaatgcatgtttactaaacatactctctgggtcag
gccctgggctaggtgctgggtgcatagcagtgactgagacctatatggccctgcccccag
AGAACTGACATTCCCAGTGTAACATCAGAGCTCAAAGTCACAGAGTTACTTAATTATAAC
TTGGTAAAG
gtaagtatctcagatgagagctgccaagggccatgagactgagataggggtcctggccta
atctgaatagtcagggaggcttcctggagaaagaggatggacactaaaggacaaatggaa
gtctactgagtaatgaggagaaggaagaacctggagcagggagcaggggtgggggctgct

 3.03 Intr +  46780  46988  209  0  2  102   58   474 0.949  44.20
cctgagcctggagatggggaggattcatccgggtctcacgaaggcttgtggcagagttgg
aatccgaacccagtattcctttacattccgattcgctggaagcacacgcccccatttcct
caggaagccggacatcccctcactgtgttcccccatcctatcccccctccccctacccag
GTCATCCCAGACTGGAAGGAGCAGGAATGGGACCCCGAAAAGCCCAACGCCTACGCGGGC
ATCTTCCACTTCCACTTCTGGCGCTTCGGGGAATGGGTGGACGTGGTCATCGATGACCGG
CTGCCCACAGTCAACAACCAGCTCATCTACTGCCACTCCAACTCCCGCAATGAGTTTTGG
TGCGCCCTAGTGGAGAAGGCCTATGCCAA
gtaggtgccagcagcaggcaggtgggtgggaggcccagacgggggtggcaccggatgggc
tcctcgtggtattccgttagccagggctttaggcacagagaagtgaggggctggtgcagg
cacgcagcaggctcaaccgccaggcctgagggcatagtcagctgagcctgtgctgggtgg

 3.04 Intr +  48433  48625  193  1  1   39  100   351 0.999  31.42
gccttatatgttggcccgagtgttaagaactgggttccagtgttggctccgccgtggcct
gctgcgtgactgtaacaggttgtttgacccctctgagtttcaaaaacctcccctatgagg
taaaggatgcagcctggctggggagcatgagctgggaagtctttccacattgcttcccag
ACTGGCAGGCTGTTACCAGGCCCTGGATGGAGGCAACACAGCAGACGCACTGGTGGACTT
CACGGGTGGTGTTTCTGAGCCCATCGACCTGACCGAGGGTGACTTTGCCAACGATGAGAC
TAAGAGGAACCAGCTCTTTGAGCGCATGTTAAAGGTGCACAGCCGGGGCGGCCTCATCAG
TGCCTCCATCAAG
gtgagaacacggcagtccccagaggcgacccctccccttcaccctcgctgactgagatgg
gagacaactgtgacatcccacgctcaggtcagctcctacgtattcagaccctcagcctcg
tgggggaggggagaagttggaaggtgcaaccccctgcccagaccctctaggctgtgaaaa

 3.05 Intr +  49586  49779  194  1  2  116   66   339 0.975  33.31
ctttactgagactgctgcccatgggggttttaaagctctgtgaacacagcactgccccat
gactgcaattcccatcccatcctgtaggtcccgtgcagcctcctagccctccagcacctg
agtccctggtctgggttccagtgtggccctgcctctctgagcaactgtgtccctccacag
GCAGTGACAGCAGCTGACATGGAGGCCCGCCTGGCGTGCGGCCTGGTAAAGGGCCACGCA
TACGCCGTCACTGATGTGCGCAAGGTGCGCCTGGGCCACGGCCTACTGGCCTTCTTCAAG
TCAGAGAAGTTGGACATGATCCGCCTGCGCAACCCCTGGGGCGAGCGGGAGTGGAACGGG
CCCTGGAGTGACAC
gtgaggcctggggatgggggtgcaggcacagggcatgagggcttggacaaggacgggtgg
gcttcttggaggagttggcactggggctgggccttgaaggatctgggggaggatgacact
aggaacgaagaagggagaattactttgcagtggttgtatggggtgatggattgagcacaa

 3.06 Intr +  50417  50494   78  2  0   58  105    94 0.981   7.26
ggagacaggcagggcttcctggagaggggctgggcatggcctcagtgcccctggccacac
cgtgccgctggaggcctggtgcaagactgcccctcgtgcctcctcgcctttgccagacag
attctggtggggctgcctcttagacagctccctttctcctccccggccctgacaccccag
CTCGGAGGAGTGGCAGAAAGTGAGCAAGAGTGAGCGGGAGAAGATGGGTGTGACCGTGCA
GGACGACGGTGAGTTCTG
gtgagtgtgtatgtgccctgggcgtccggggctgagggggcttcccacgggcctggcggg
gagcaccaggtggggagtcaggagccaggcctctcctgcatgccccatcatcaatttgct
gtgtggccttggacaagtcacaccatctcagagcctgtttcctcctctgtaaaattagtt

 3.07 Intr +  52348  52543  196  1  1   65   80   423 0.996  39.14
gaggttaagggtctgtgcaatgccatgcctgtgcccttgtgtgggcttagctcccctctc
aaagccagctgtgttctctcacctctgggccatatggacatattaggttgttgggctggg
gggccaagagcctggggaggtgtgggggaggtaccctgctcagcccctccccacatccag
GATGACCTTCGAGGACGTGTGCCGGTACTTCACGGACATCATCAAGTGCCGCGTGATCAA
CACATCCCACCTGAGCATCCACAAGACGTGGGAGGAGGCCCGGCTGCATGGCGCCTGGAC
GCTGCATGAGGACCCGCGACAGAACCGCGGTGGCGGCTGCATCAACCACAAGGACACCTT
CTTCCAGAACCCACAG
gtgggcgttctcaggaacccccaccctgccctgtagcagctgcggggtgccttgccactg
tcctgccagggactcctgcatgaccttgggtaatccctgtccttccttgggcctcagcaa
acctgtctgtacagtgggggttagatgggcacatccgtcccatctgggggtcatgaagcc

 3.08 Intr +  53221  53343  123  0  0   51  100   256 0.968  24.39
ccttcatgcagggtagccattgcaggcattggtaggcccacctcacagcagagggaccaa
ggcgcagagaggtgctgtgactggtccaggctctggagtctgagcttccgggagccagcc
agcccatgcctggtgtggtctcattgcagtgtctctctctctccttggccacacctgcag
TACATCTTCGAAGTCAAGAAGCCAGAAGATGAAGTCCTGATCTGCATCCAGCAGCGGCCA
AAGCGGTCTACGCGCCGGGAGGGCAAGGGTGAGAACCTGGCCATTGGCTTTGACATCTAC
AAG
gtgaggccagccgggtcccctgccgtgggtggggagagggagggagctggagtttggact
gcccatgcctgaggaagaacgctctagaacaccttggtcactgccgctgccctggctgcc
gtggcagacattgtgaggatgccgtggcatgggccccacttgaatattcacagagggccc

 3.09 Intr +  54904  55100  197  0  2   93   37   489 0.890  43.03
ctcttcccttcagccctgggcaaacacgaatccgcttctgttattatagatttgcctgtt
ccggacatttcatataaagggattccatcgtcccttccatggtggtgagggggaggcggg
gtgggccagggtgttgtagggtgtgtctccgcgtggcccagcccctcccgcctcctgcag
GTGGAGGAGAACCGCCAGTACCGCATGCACAGCCTGCAGCACAAGGCCGCCAGCTCCATC
TACATCAACTCACGCAGCGTCTTCCTGCGCACCGACCAGCCCGAGGGCCGCTATGTCATC
ATCCCCACAACCTTCGAGCCAGGCCACACTGGCGAGTTCCTGCTCCGAGTCTTCACTGAT
GTGCCCTCCAACTGCCG
gtacttgggggctggcttgaggccagtgtgggtgggagtgacattcacactgggccaacc
aggaacctgcagcctcagagatgctcagtgtctctgggcctccagccactctgggctgat
accagtgcccatctccttcccttctcttcccttgttcccctgtcccagcatccctggcca

 3.10 Intr +  56125  56240  116  1  2   73   99    99 0.998  10.09
gcaggaagcccacagggcttggagctggggactgcccatggggatttgctcaggactaaa
tgaaatcaagtttgggctaaatactgcttctcttcccttcccacttcctgaaccccctct
tcacccctgtcttcctggcccttctccatcactcccctctcccctgccgccccatatcag
GGAGCTGCGCCTGGATGAGCCCCCACACACCTGCTGGAGCTCCCTCTGTGGCTACCCCCA
GCTGGTGACCCAGGTACATGTCCTGGGAGCTGCTGGCCTCAAGGACTCCCCAACAG
gtgagctctcccagggagagtcccccggccctcctgccagttgtcccatggcctctctcc
accagcacggataccagcctcagagctctcctgctctcagaggcactgcaggcctggcca
tttctggggtgatgcctgatgctgggcacatagagaggaaaaggtttaccttctgctctc

 3.11 Intr +  56767  56903  137  2  2  125   99   232 0.999  28.80
tggccagtgtgcccctgctggccggcctgtctctggaaacgaaggggccctgaggtgggt
caggctccagtctctccatctgaataactgagccgggtgggcatctcacctgtagatatc
tgtggccctgccacagcccccacccccaccctcaccccatctcccactccctctccctag
GGGCTAACTCTTATGTGATCATCAAGTGTGAGGGAGACAAAGTCCGCTCGGCTGTGCAGA
AGGGCACCTCCACACCAGAGTACAATGTGAAAGGCATCTTCTACCGCAAGAAGCTGAGCC
AGCCCATCACTGTACAG
gtgagccccctggtccagaggccacctcctgggctcctagcctgaggcttccccactcag
ggggacaagcccaggtggaagaccctctgacgaggacccaggcatgctgggctctagctg
tctgtctatccctgacccctggtgtggctttgggagctctcttgccactccaaggtccct

 3.12 Term +  57879  58061  183  2  0  120   47   248 0.999  21.76
ggctctggaaggggcaccaccttgcccgtagttcatggggaggcagacagcccagggccc
ccgatcctcagccaggcttgcacttcaaggccctgccaccaccaccagcaccccccatag
acctatattgctggtcttggaggtagcccgcccctcccatgatcctctgtctcttcccag
GTCTGGAACCACCGAGTGCTGAAGGATGAATTTCTGGGCCAGGTGCACCTAAAGGCTGAC
CCGGACAACCTCCAGGCCCTGCATACCCTCCACCTCCGGGACCGAAATAGCCGGCAGCCC
AGCAACCTGCCAGGCACTGTGGCCGTGCACATTCTCAGCAGCACCTCCCTCATGGCTGTC
TGA
cacctgcccacctacctggctctgaccgttcccaccaccatctgcatgtccccactgggc
ctgagtctagcctgggagccaggatactggggtccttttcccactcttccactgacttgc
tgtgtgaccttaggaagtctctgcccctctctcagcctcagtgtcccgagggccccgaag

Predicted peptide sequence(s):


>CAPN5_1|GENSCAN_predicted_peptide_1|245_aa
MGGGRGRGGAEPGPAGRTRGMRAPAPAAGQSQLDLRPEPEAAAPGGCSLRSSARAVPCIP
GARLDPRRLGRGHAREGAGDQSTSKPIHWSPAALHCQDVPPGMGHLMLTITLQGGGAGES
RFTGENTKAYYGQVLSGTPSCIYLLSALSLQDLVLDWEPRALQSWFCQLPPRLRPPSALP
PFPSPCATLYPAVPLLLLAYPSGPARAPSRKATTIHPQPPPHQPAQRQPKSGTSKDVQVG
VDCVP

>CAPN5_1|GENSCAN_predicted_peptide_2|501_aa
MGLMMSASQGTSGTQGLCVPPPLPGAAATMFSCVKPYEDQNYSALRRDCRRRKVLFEDPL
FPATDDSLYYKGTPGPAVRWKRPKPGSQYGTMDTDNDEQVASLRPLLLVPEARVCYTEMF
GLLARYVFVLSSTVAIRWPLTGLAGEMHGEWRMSPGLGAQGVRPPRSGPGTWCPKVAPGF
QSRLQVRPKVAQQGADIQIRSSCLCHPLLAACGRTAEALGMELAQERLLEWRQAEGCCHL
PMLCGGDMGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKLFSKGGLV
IPSFMTPSSKLLVFWTRAKGFGLQPTWVLGVGGSSTWAMAEDRPQQPQLDMPLVLDQGLT
RQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITG
TSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFL
VTFGEGVEPANLKASVVFNQL

>CAPN5_1|GENSCAN_predicted_peptide_3|581_aa
MESRAFRTGQEQKEGVKRTDIPSVTSELKVTELLNYNLVKVIPDWKEQEWDPEKPNAYAG
IFHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDG
GNTADALVDFTGGVSEPIDLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAAD
MEARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWNGPWSDTS
EEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVINTSHLSIHKTWEEARL
HGAWTLHEDPRQNRGGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKG
ENLAIGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGH
TGEFLLRVFTDVPSNCRELRLDEPPHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGANSY
VIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKA
DPDNLQALHTLHLRDRNSRQPSNLPGTVAVHILSSTSLMAV