GENSCAN 1.0	Date run: 15-Jan-104	Time: 00:16:42

Sequence ALX4_1 : 47958 bp : 53.03% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1305   1811  507  2  0   71    1   645 0.658  49.11
agagaaagaagagggggagagagagagaggccggcgtggaggggaggagggagagcgagc
aggccgggcaaggagtgcacagccacagcctcctcgcctccccaaactcccagccaaggc
gcgcggtggcgtcctcgcgccctcgctcgcgtccccgcccgccgcctgcgcaagccaggc
ATGAATGCTGAGACTTGCGTCTCTTACTGCGAGTCGCCGGCCGCTGCCATGGACGCCTAC
TACAGCCCGGTGTCGCAGAGTCGGGAGGGCTCGTCGCCTTTTAGGGCATTTCCCGGAGGC
GACAAGTTCGGCACAACTTTCCTGTCGGCCGCCGCCAAAGCACAGGGATTCGGGGACGCC
AAGAGCCGGGCCCGTTACGGCGCTGGGCAGCAGGACCTGGCGACACCCCTGGAGAGTGGA
GCTGGGGCGCGGGGCTCCTTTAACAAGTTCCAGCCCCAGCCGTCGACCCCGCAGCCCCAG
CCGCCGCCGCAGCCGCAGCCGCAGCAGCAGCAGCCGCAGCCCCAGCCGCCCGCGCAACCG
CATCTTTACTTGCAGCGAGGCGCCTGCAAGACGCCCCCGGACGGCAGCCTCAAACTCCAG
GAAGGCAGCAGCGGCCACAGCGCGGCCTTGCAGGTTCCCTGCTACGGTGAGTGCACGTGC
GGGTCACCTGGTGCTGGGGACCACGGG
gtgcttggcttccgcatcccttgaaactggtggcttgcgggaggtatgagttggcgggct
gggggcggggtggtgactctggtcggtaaacgggatcgatcgctgcgagggagccaaggg
atctgttctgtctccttcttgtccgccggcctaggcacggagcgtttcggctgttaaact

 1.02 Intr +   1966   2277  312  0  0   65   94   196 0.776  14.83
ggtcacctggtgctggggaccacggggtgcttggcttccgcatcccttgaaactggtggc
ttgcgggaggtatgagttggcgggctgggggcggggtggtgactctggtcggtaaacggg
atcgatcgctgcgagggagccaagggatctgttctgtctccttcttgtccgccggcctag
GCACGGAGCGTTTCGGCTGTTAAACTCGACTTGGAGTTTGTTTTTCCCGGTCCCTTCGGC
ATTTCCCCAAACCGCTCGCTTTGCGCTGCCCGCTGGGCGGGATTTGAAGCGGATGCTTCT
TACCGGCCCAGGGCGTGCGGCGGCAAGGAGTCTCCGCGCAGCGCTCTGGCGCTGGGCTGC
GGGGCTGCGGGGCTGCGGGGCTGCGGGGCTGCGGGGCTGCGAGGCTGCGGGGCTGCGGGG
CTGCGGGACAGCAGGACTGCAGAAGCCTCGCTCCTCGCCGGCTGGGAGGCTCCTCGGGCG
GCGCCGCCGCAG
gtgagagcgccgcaggtgcggagccaggcgggaagcccggagcgtggttggccgaaagct
cacgggaaatccaggcgcactggcgcaacacagtgcggagccagagaccctagggtccca
ggggacactgtggtctggcaagacccgagtcctgggaccctgagcgctactggcagtggg

 1.03 Intr +   4929   5058  130  2  1   76   77     2 0.265  -1.33
gtgccagtactggcgctggctgatctccgtcttcaggcaggcagctgagacctggcaacc
attcctagccctggaggtcggggcgaaagctgttctttcacgtgtgtaactacacctaac
aaaagggggaagctcggaggcctcttcctgggcctcaacttctgggcccactcccggcag
AGTCCAATTGCCTCTCGGCAAGGAAGGTGCCCCGGGCAGCTGAGCCTGGGCCAAGCCGAG
GGAGTGCGGGGCGGGGAAGCCGCCTCCAGTCTCTGCTGGCCGGGTCTGGACCGGGTTGCG
GAAAGAGTTG
gtgagagaaaccctcccgggctgcaagcgtccctaccccaacttgggccttcctttcccc
aaatgtgctaaaagaacgacgattaaggcggctccgcagtgtcctttgggtgcggagacc
gcgtttttacgaaagagcccccaccgagccctcttctgttgcaacccaagacttcaccat

 1.04 Intr +   7133   7280  148  0  1   79   94   168 0.334  16.30
gaacgcttaaccagagagaacttcctgcccccggagcctcagcgtccttagccccccaaa
cccctgttcaggaagccgaaggacctaggcccaggcaacggtttggggtggggcggtaag
agcgccgtcctgcacccggacgtcgcctgccaggcgccacctggccatgtgcgcccgcag
CGCAGGGTTCTCCGGCCATCAGCACAGGTCCTCACCGAGGTGACAGTCATCGGATTGGGA
AACCAACACTGCGAGGACCCGGCTATGTGATGATACCGTCCGGGGGAATTCGAGTGGAAG
CCGACCGTCCTGTGGTGCCACTAGACAG
gtgagaagcagcccttccaaacagggccctttgctggaaggaggaggcacctctttccag
ccagtgagccttcccagctgcaaccggggtcttctctaatatcagttaccgcggcctcca
gaggtgcagcccggcacacctcttctctgcagatgtataaaccggggacacccccatctc

 1.05 Intr +  10647  10770  124  0  1   68   17    56 0.093  -2.41
ttaaggggagggtgcaggaaagttgggggaagttgggatttgtccaggccaatgagtttt
ctctagtggctggaaatcctgaggcttcttctctcttgactttctccttttctccctcca
tgctttctcttggtttttctatggaaatagtcatgtataacagcccccttacttctctag
TGCCACTCCATTTCTCCCTGTGTTGAATGGCACTTTGGCCCTGTCCCACCTGGGAGGGGA
GTATGAGGAGGATGTGATGATGGAGAGAGGTAGTGTGTCTGCCCCGTACATCCTGCACCA
CCAG
gttctctgccccacccctcacactataccctttgagggtgctaggatattgcaaatgata
gtggtggggttctgatcaggttttagagtgtgtatgtagagtttggggtcctcctggata
tgtgagcctccccgatgtctctatgtggccacaaggatccattcacacctggctcacatc

 1.06 Intr +  15343  15408   66  0  0   93   85   108 0.459  10.59
atcgaccggtcttgggacctttgttgaaaatcaattgcgcatgtatttgagagtttacat
ctggtctctattctgttgcatttgtctatctggcccctgaatgatcttctgatgtgaagt
ccaggattgcagaatgtacaaggacccttgtaggccatccgttcatctccttgcctgcag
GCCAGTGACCAACAGGTCACAGAAATTCAGCTCAAGGACACATTTGTTTTCCGGGACCTG
GAGCTG
gtgagaaggggtggagggcagagccaaaggcgaggactctagagccacagtcttggccct
ggctaggcccctggatattcgggggcccctctgccccttcagttgaccatcccatgagga
cgtggcctttggggaaattcttttgtgctctgagggtctatacacccacctcctgagatg

 1.07 Intr +  17071  17196  126  0  0   73  100     2 0.218   1.28
tgagctggggaataactctctccctgctgaatgtgttttctgtgtttatttgacccagaa
cttcagcctgtccccagggcaggggttctgctgtgttcctctctgatcagcacagggctg
agcacagagaatcgggctcagggaatgtcaggcaacctctgcacccttcctgggccccag
CTTCCTGGGCCCCATCTGCAATTAAGAAAGCACCTGGTGGGCATTGCCCTTGGCCACACC
TGGACTGAGACTTTTTGTGGAAACCCACTGGGAGATATTAGTATCCTCAATTTGAAGATG
AGGAAG
gtgaggctgtcccgctgtgaattgaacccagatctcctgaagccaaagagcctttttcct
cccctgcccagggggctcatgcccactgcctggatgccctcatgcctatgtgcccatcag
acttgaccagcatgtgagagctctgtagacggtggagggggtgcactgggaggggttttc

 1.08 Term +  17479  17550   72  0  0  113   43    22 0.301  -1.60
tgcctatgtgcccatcagacttgaccagcatgtgagagctctgtagacggtggagggggt
gcactgggaggggttttcagcacactgcatgttgtacgtgggctacaccatcttcgccca
tctactgaaatgatgaccatgtcccctgaccgcccagacaccactccctcctccctccag
AGCCATCCTGAGAACCAGGCCAGCCCAGCCCAGGACCCCCATGTGATATGTGGGAGCAGC
TCCTGTGGGTAA
agaaggaggagacaaacccttctaaacagaacgagtaatagcctcctcactagcccagtg
ttggcgaagccaggggcaagaggccagtttggaaatattacttgtaccatgtggcaggtg
gacagtgagggccaggcctcctcagggaatgtatgtgcccaagctctgctgtattaatgc

 2.01 Init +  27636  27715   80  2  2   69   78    43 0.051  -0.09
gagagagacaataaacaaggggaaaacagaagaacaaataaatacctaatattggcgcgg
tggtccatgcctgtaatcccagcactttgggagaccaagacgggtggatcatttgaggcc
aggagttcaagaccagcctgggcaacatgaggaaaccccgtctctactaaaaatacaaaa
ATGAGCGGGGTGTGGTGGCCCATGCCTGTAGTCCTGGCTACTCAGGAGGCCGAGGTCCGA
CAATCGTTTGAATCTAGGAG
gtgaggttgcagtgagccgagatcgaaccactgcactccagcctgggtggcaaagcgaga
ctctgtctcaaaaaaagaaacaacgtgcagaataaagactatcaggaaggatcttccatt
tatggaaatatcatcctttatttaaccaatcccctattgttgaatattttgattactgtc

 2.02 Intr +  32544  32569   26  0  2  138   93    15 0.225   5.15
ttcagggaatttttctttgttgtctaaatgaggaacccagcctcagaatttaaagcaagc
tgactcaagacaggttagaaggcttgcttccttcttccttgaggaaccaggagcagcgct
cccctgaattccttccatctctgacacaggcacaccctccccctctcctcccctccccag
GTCCTCAGGGACAGTCCTGGCTGCTG
gtgagcaagggaggagggaccctcaactaccccgctctccctatttgtaggtgagactcc
agagatgaaatgggtcatctgaagtcctgagaagagcgggggccgaggccagggctccca
actcttggcctggtggtcttcgcacaccctgtgccacctctatctctgcctgctcacttg

 2.03 Intr +  35709  36019  311  1  2  120   82   450 0.201  44.18
cacacagcaagttaatggcaagccagaattagaagccaagtctccggacctcgcatccaa
tgagctctaagaggaaaaaggcagggggtggctacccgagtgccccactctccccctgac
attccccttctcttgtttggttcaaccattggtttctgactttgtttcctcctccctcag
CTAAAGAGAGCTCCCTGGGTGAGCCAGAGTTACCCCCTGACTCTGACACTGTGGGGATGG
ACAGCAGCTACCTGAGTGTCAAGGAGGCTGGGGTGAAGGGGCCCCAGGACCGGGCCAGCT
CAGACCTCCCCAGCCCATTGGAGAAGGCCGACTCAGAGAGCAACAAGGGCAAGAAGCGGC
GGAACCGGACCACCTTCACCAGCTACCAGCTGGAGGAGCTGGAGAAGGTCTTCCAGAAGA
CCCACTACCCAGACGTGTATGCGCGGGAACAGCTGGCCATGAGGACAGACCTCACTGAGG
CCCGCGTGCAG
gtcagtgagggccacctgggagtgaggctggtaaagcagagcctgtccctgggctcttgg
ctgcagttggggtctcctgactgcccaccaaccacaccatggctttcctttcctcagttc
attgagaacctgaaagtgggggctcctagcctgcccctcatgcccctgtcccaactagag

 2.04 Intr +  43745  43873  129  1  0   97  111   193 0.998  23.90
gattctagattgtcagctcttgaggacaaagaccaaggttgatatttatgtgtggccgca
ccgtttcccaaacgcactgcaactgatggggggctcaagggaacagtttgcactgcctga
aagtgaggcctccaggcgggcatctcaccctggtgacaatggctttttcgcgtcttgtag
GTCTGGTTCCAGAACCGAAGGGCCAAGTGGAGGAAGCGGGAGCGTTTTGGGCAGATGCAG
CAGGTTCGAACCCACTTCTCCACTGCATATGAGCTGCCCCTCCTCACCCGAGCTGAGAAC
TACGCCCAG
gtaagtcccgccctgagctgccgccaccgatccccagcccctggtgctctgagaatgagc
cccttggaggagagcccaggcaccccgagatgacttatggctccaggctgcccttccgtc
tcattccaggggtgtgcctgtttataccagagtgtgggaggcccagggttaatctatcca

 2.05 Term +  46184  46513  330  1  0  111   48   482 0.856  41.51
tgccaaggtgtaaaagccacccccacaggggtatctggatgtccatcaaggctaaacact
caagaggggcttcatgggaaggatggacagtgaggggagaggtgctctgggggaaggggc
gagccccttccacaccacacctgcccgccagccggtgacatctctcccttcctctcccag
ATTCAGAACCCGTCCTGGCTCGGCAACAACGGGGCTGCCTCACCAGTGCCAGCCTGCGTG
GTCCCCTGCGACCCGGTGCCTGCCTGCATGTCCCCTCATGCCCACCCCCCTGGCTCTGGG
GCCAGCAGCGTCACCGACTTCCTGAGTGTGTCTGGGGCTGGCAGTCACGTGGGCCAGACG
CACATGGGCAGCCTGTTTGGAGCAGCCAGCCTCAGCCCAGGCCTCAATGGCTACGAGCTC
AACGGCGAGCCGGACCGCAAGACCTCGAGCATCGCGGCCCTCCGCATGAAGGCCAAGGAG
CACAGTGCGGCCATTTCCTGGGCCACATGA
cagggcacccctgccccgtccccacctcgggacaccatgggccacgcccatgttttccag
gcccccagcctcccactcgactttcctcttaggaacctggcctgggccaggggcctgacc
ctcagcactttcagccgccccaagtctgaggccccgtggactgctgggagggagggggca

Predicted peptide sequence(s):


>ALX4_1|GENSCAN_predicted_peptide_1|494_aa
MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSAAAKAQGFGDA
KSRARYGAGQQDLATPLESGAGARGSFNKFQPQPSTPQPQPPPQPQPQQQQPQPQPPAQP
HLYLQRGACKTPPDGSLKLQEGSSGHSAALQVPCYGECTCGSPGAGDHGARSVSAVKLDL
EFVFPGPFGISPNRSLCAARWAGFEADASYRPRACGGKESPRSALALGCGAAGLRGCGAA
GLRGCGAAGLRDSRTAEASLLAGWEAPRAAPPQSPIASRQGRCPGQLSLGQAEGVRGGEA
ASSLCWPGLDRVAERVAQGSPAISTGPHRGDSHRIGKPTLRGPGYVMIPSGGIRVEADRP
VVPLDSATPFLPVLNGTLALSHLGGEYEEDVMMERGSVSAPYILHHQASDQQVTEIQLKD
TFVFRDLELLPGPHLQLRKHLVGIALGHTWTETFCGNPLGDISILNLKMRKSHPENQASP
AQDPHVICGSSSCG

>ALX4_1|GENSCAN_predicted_peptide_2|291_aa
MSGVWWPMPVVLATQEAEVRQSFESRRSSGTVLAAAKESSLGEPELPPDSDTVGMDSSYL
SVKEAGVKGPQDRASSDLPSPLEKADSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPD
VYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRAENY
AQIQNPSWLGNNGAASPVPACVVPCDPVPACMSPHAHPPGSGASSVTDFLSVSGAGSHVG
QTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISWAT