GENSCAN 1.0	Date run: 15-Jan-104	Time: 01:10:29

Sequence ADAMTS15_1 : 27247 bp : 51.83% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   2157  957  0  0   90  109  1366 0.960 130.49
gccgggtgcacgctcgccgccctgggaggagtctccctcccttggctctcctttctggga
actgccggctgtcccgtagcgttggcggttccagagtgcgggctgcacggagaccgcggc
agcggccggagagcccggcccagccccttcccacagcgcggcggtgcgctgcccggcgcc
ATGCTTCTGCTGGGCATCCTAACCCTGGCTTTCGCCGGGCGAACCGCTGGAGGCTCTGAG
CCAGAGCGGGAGGTAGTCGTTCCCATCCGACTGGACCCGGACATTAACGGCCGCCGCTAC
TACTGGCGGGGTCCCGAGGACTCCGGGGATCAGGGACTCATTTTTCAGATCACAGCATTT
CAGGAGGACTTTTACCTACACCTGACGCCGGATGCTCAGTTCTTGGCTCCCGCCTTCTCC
ACTGAGCATCTGGGCGTCCCCCTCCAGGGGCTCACCGGGGGCTCTTCAGACCTGCGACGC
TGCTTCTATTCTGGGGACGTGAACGCCGAGCCGGACTCGTTCGCTGCTGTGAGCCTGTGC
GGGGGGCTCCGCGGAGCCTTTGGCTACCGAGGCGCCGAGTATGTCATTAGCCCGCTGCCC
AATGCTAGCGCGCCGGCGGCGCAGCGCAACAGCCAGGGCGCACACCTTCTCCAGCGCCGG
GGTGTTCCGGGCGGGCCTTCCGGAGACCCCACCTCTCGCTGCGGGGTGGCCTCGGGCTGG
AACCCCGCCATCCTACGGGCCCTGGACCCTTACAAGCCGCGGCGGGCGGGCTTCGGGGAG
AGTCGTAGCCGGCGCAGGTCTGGGCGCGCCAAGCGTTTCGTGTCTATCCCGCGGTACGTG
GAGACGCTGGTGGTCGCGGACGAGTCAATGGTCAAGTTCCACGGCGCGGACCTGGAACAT
TATCTGCTGACGCTGCTGGCAACGGCGGCGCGACTCTACCGCCATCCCAGCATCCTCAAC
CCCATCAACATCGTTGTGGTCAAGGTGCTGCTTCTTAGAGATCGTGACTCCGGGCCCAAG
GTCACCGGCAATGCGGCCCTGACGCTGCGCAACTTCTGTGCCTGGCAGAAGAAGCTGAAC
AAAGTGAGTGACAAGCACCCCGAGTACTGGGACACTGCCATCCTCTTCACCAGGCAG
gtgagttgatctgccgtcactttgcacccagatagtcccgttctttagggtcacctcccc
tagcgctccaaatcccctttgtatcgtgcaatgcctccgagtttaaacctcgttgatctc
ttccgactccaactctgtggagtttccagggagagccctctcccacgctccgcggagcgg

 1.02 Intr +   2221   2618  398  0  2   55   82   180 0.158   8.05
gtcaccggcaatgcggccctgacgctgcgcaacttctgtgcctggcagaagaagctgaac
aaagtgagtgacaagcaccccgagtactgggacactgccatcctcttcaccaggcaggtg
agttgatctgccgtcactttgcacccagatagtcccgttctttagggtcacctcccctag
CGCTCCAAATCCCCTTTGTATCGTGCAATGCCTCCGAGTTTAAACCTCGTTGATCTCTTC
CGACTCCAACTCTGTGGAGTTTCCAGGGAGAGCCCTCTCCCACGCTCCGCGGAGCGGCGG
CTCACGTGCATCTGGGCCATTGGAGGAGAGCCTGCGCTTTCCGAAGGTGTTGGCCTGGCG
CGGCCAATCAGCGCCTCCTGGATCAGGCGCCGAGGGGCCGGAACCCAGGAAGTTGCCGCC
CCGGAGCTGCAGTTTGTGTCCAAGACCGATAGGAGACGCCGTGAGGATGGTGTTGGAGAG
GGCGGGAACGGCCCACCCCTATTGTATGGGCGGCTGAGTCTTCTCGGACACCTCCTGAGG
TCTCCTTTCAAGGGTTGTAGAACTGAAGGTGATCCAAG
gtcagcgcttgctacatttctctcgggtaacacgttgtcccctctctgtactgggcctgg
aaagcctggattggggtggagggaatcattgagagattttgtgggttgcagtgacaggcc
agactcaagtactgcgagcatccctccttcactgccgcttctcctacagacttctctgct

 1.03 Intr +   9678   9834  157  0  1   58   91    49 0.001   2.73
tccctctgtctttgtactgctggaaaacattgagcatcttggtacatgcctgggaaatga
gaagaggtaggaaggtggttcacagggatggcagctggtgggaatcgtggtggaggtgtg
tatggagtgacactggtaaacaagctactgtcagatgttatccttgtttatttatttaag
GTGTGGCTCCAATCCTAAATTATTTTATAAGAAGGGACAGTTAGAAAATAACAGTCCAGG
AGGATTAAGGTTCCTGGCCAAGATGATTCCAGGATCATCTGGAAAAGTGGCTGCAGCTAC
AAAGAAAAACAGCCAATTGCTGGGAATCGTGAGGCAG
gtaggggctgggttaggaatacctacaccttctgggaggaagaaggcagaacagcttctg
ttttttggaggcaagcacttgggctgaagaggttaaggcagttttagtgcctctgagttc
attccagaagggtggagatttttgatgccacaaaggaggcactgctgggcccctgtataa

 1.04 Intr +  13716  13848  133  2  1   79   82   133 0.714  12.52
gattctgtgaacagccccacaacctcctaggaagaagagcccagctggaaggtgctgggc
ctggtgaggttggaatgagatgagctggaatgtcctataggatgtcctttcttcccttca
ggtcccttctgtcactgtctctaacttcgggctggcttctgcttctcccccacccggcag
GACCTGTGTGGAGCCACCACCTGTGACACCCTGGGCATGGCTGATGTGGGTACCATGTGT
GACCCCAAGAGAAGCTGCTCTGTCATTGAGGACGATGGGCTTCCATCAGCCTTCACCACT
GCCCACGAGCTGG
gtaaggctggataagctcctcctggggtcttctgggtttgcctggggagcctggagggtg
ggagacgtgtgtctttgcccccttgtgttctgaagccttaggaccccttcttagggcaca
gtgagccttagcagcagctttgtactttttccgattgccccagccccgctggccaatgac

 1.05 Intr +  14314  14481  168  2  0  132  115   278 0.878  35.33
ggaggggacagaaaacacaagaacatgatcttgaggacatttgaaagcagtctgtcgata
gttggcaatgaccagcctgaaaacctctgacatgggctttctagttcccctgccccattc
ctccctccaacccccatgtccttcctcctgccctctcagtcctcttgccttaccccacag
GCCACGTGTTCAACATGCCCCATGACAATGTGAAAGTCTGTGAGGAGGTGTTTGGGAAGC
TCCGAGCCAACCACATGATGTCCCCGACCCTCATCCAGATCGACCGTGCCAACCCCTGGT
CAGCCTGCAGTGCTGCCATCATCACCGACTTCCTGGACAGCGGGCACG
gtaagccaggacggcgggagggcaatgaggccgcctcggagggggctttgctgctgcccc
tggtggaggtgctcacttctccgtcctctgtacattaggtgtgtgtgccccctcggagcc
gggctctgacatgagtgcattcctgttgcccttggttcattatccccttaccattcagat

 1.06 Intr +  14724  15007  284  1  2  130   96   377 0.650  40.38
gtggaggtgctcacttctccgtcctctgtacattaggtgtgtgtgccccctcggagccgg
gctctgacatgagtgcattcctgttgcccttggttcattatccccttaccattcagattc
tgggctagccaaacctcatcttcccagctcatcctaacgaacgccctcggctctctgcag
GTGACTGCCTCCTGGACCAACCCAGCAAGCCCATCTCCCTGCCCGAGGATCTGCCGGGCG
CCAGCTACACCCTGAGCCAGCAGTGCGAGCTGGCTTTTGGCGTGGGCTCCAAGCCCTGTC
CTTACATGCAGTACTGCACCAAGCTGTGGTGCACCGGGAAGGCCAAGGGACAGATGGTGT
GCCAGACCCGCCACTTCCCCTGGGCCGATGGCACCAGCTGTGGCGAGGGCAAGCTCTGCC
TCAAAGGGGCCTGCGTGGAGAGACACAACCTCAACAAGCACAGG
gtgagtgagtgctggagctgcgctcggggactgctgggaggagggatggagacccggggg
cctcgtctgcccttggtcttcaccaggaaggtgcctatcacagactggccacgggaccag
cactgttgcatggctgagctgtgccttcactgccctgtatatagtcctatccccttcttg

 1.07 Intr +  17836  17904   69  0  0   77   86    21 0.221   0.67
gccttttagaatacaaacctgttgtaatttctcccatctgaaacaaaacttcttatgatc
ccacttcctctgtggtctgtttctctgactcccttcacagcaggttcccggaaggagttg
tacaagcttgctgtctccaattccatcttcccacttttctctgctgcccattccaaacag
GCTTTGACTGACATCATTTCTCCAAAACAACTCTTATTAAGGCTACCAAATGGCCTGCAC
ACTACGAAG
gtcagtgactgttacctttcctcccatcgtccagccggctagcagcatttctggcaaccc
agagctctgggccctggaacagggtctccactgcctctcggttgtcctcctcctcctcac
gctgcccctccccttctcattacctttactgcttcttccttgtactctcattttcttttt

 1.08 Intr +  21489  21666  178  2  1   22   94   107 0.638   4.71
ggtgggcttggtgtgcactggccatttgtttattgttttttccttcatgatacaacatta
atttcattccaggaaggtgggatgagaacttggaggctgtacagtgtagttttctatggg
ctgaggggctgggtgtggcacctggatccaccaaggaatataacaggctcttcctcacag
GTGGATGGTTCCTGGGCCAAATGGGATCCCTATGGCCCCTGCTCGCGCACATGTGGTGGG
GGCGTGCAGCTGGCCAGGAGGCAGTGCACCAACCCCACCCCTGCCAACGGGGGCAAGTAC
TGCGAGGGAGTGAGGGTGAAATACCGATCCTGCAATCTGGAGCCCTGCCCCAGCTCAG
gtgaggtggggagagcagtggtggcctgggcccaggggaggtgaggctggaggtcccccc
accccacccctactccatgtaatgcatggcctccaggtaattgggtacacaggtaattca
ggtagtctagtatttctatcatggattcctgctgatgacaaagggactgcagtcaggatt

 1.09 Intr +  23147  23328  182  0  2  126  113   330 0.998  39.40
tgcgccctgggtcctttgggcccagcctgctttagtgctttcagatggggggaggttgca
gctttggtgatgagggtgggaagggctaagagagccacggcaggctgggagggaggcttg
tcctttgcaccggccttgtcccttcccctcaacttctttcttatgcttctccctccctag
CCTCCGGAAAGAGCTTCCGGGAGGAGCAGTGTGAGGCTTTCAACGGCTACAACCACAGCA
CCAACCGGCTCACTCTCGCCGTGGCATGGGTGCCCAAGTACTCCGGCGTGTCTCCCCGGG
ACAAGTGCAAGCTCATCTGCCGAGCCAATGGCACTGGCTACTTCTATGTGCTGGCACCCA
AG
gtgagtgagcctggggcctgagaacaaagtagggaccaggtcttccggggagcatcagct
gagctgccctgctcttccttctttttccccttctggggtgctgcaggtggtggacggcac
gctgtgctctcctgactccacctccgtctgtgtccaaggcaagtgcatcaaggctggctg

 1.10 Intr +  23435  23610  176  1  2   78   84   199 0.997  17.75
tgtctccccgggacaagtgcaagctcatctgccgagccaatggcactggctacttctatg
tgctggcacccaaggtgagtgagcctggggcctgagaacaaagtagggaccaggtcttcc
ggggagcatcagctgagctgccctgctcttccttctttttccccttctggggtgctgcag
GTGGTGGACGGCACGCTGTGCTCTCCTGACTCCACCTCCGTCTGTGTCCAAGGCAAGTGC
ATCAAGGCTGGCTGTGATGGGAACCTGGGCTCCAAGAAGAGATTCGACAAGTGTGGGGTG
TGTGGGGGAGACAATAAGAGCTGCAAGAAGGTGACTGGACTCTTCACCAAGCCCAT
gtgagttctgggccctgaaggtcctgccagggagcaaagggagggaggtggagtttccca
gggtattggaagcttgggttagactggggtaaatgtcagatccagccagtacccttgctg
cagaggccacccatacccttctagggctgctagtccttcactcactcattcattcactca

 1.11 Term +  25274  26048  775  2  1   89   48  1230 0.999 112.41
cagcagctttccagcaccaatcgccaaggggcagggacctctctgactccaaaacctgtg
cttttactcccatgccagaattcaccgaaagctaggtttactgaggaaaacagatcctgg
agcataaggtcctcaggtccaggcttctatctgatgcacggcccccctttcccccgccag
GCATGGCTACAATTTCGTGGTGGCCATCCCCGCAGGCGCCTCAAGCATCGACATCCGCCA
GCGCGGTTACAAAGGGCTGATCGGGGATGACAACTACCTGGCTCTGAAGAACAGCCAAGG
CAAGTACCTGCTCAACGGGCATTTCGTGGTGTCGGCGGTGGAGCGGGACCTGGTGGTGAA
GGGCAGTCTGCTGCGGTACAGCGGCACGGGCACAGCGGTGGAGAGCCTGCAGGCTTCCCG
GCCCATCCTGGAGCCGCTGACCGTGGAGGTCCTCTCCGTGGGGAAGATGACACCGCCCCG
GGTCCGCTACTCCTTCTATCTGCCCAAAGAGCCTCGGGAGGACAAGTCCTCTCATCCCAA
GGACCCCCGGGGACCCTCTGTCTTGCACAACAGCGTCCTCAGCCTCTCCAACCAGGTGGA
GCAGCCGGACGACAGGCCCCCTGCACGCTGGGTGGCTGGCAGCTGGGGGCCGTGCTCCGC
GAGCTGCGGCAGTGGCCTGCAGAAGCGGGCGGTGGACTGCCGGGGCTCCGCCGGGCAGCG
CACGGTCCCTGCCTGTGATGCAGCCCATCGGCCCGTGGAGACACAAGCCTGCGGGGAGCC
CTGCCCCACCTGGGAGCTCAGCGCCTGGTCACCCTGCTCCAAGAGCTGCGGCCGGGGATT
TCAGAGGCGCTCACTCAAGTGTGTGGGCCACGGAGGCCGGCTGCTGGCCCGGGACCAGTG
CAACTTGCACCGCAAGCCCCAGGAGCTGGACTTCTGCGTCCTGAGGCCGTGCTGA
gtggggtcatcgctttctccccctcactctccaccccactgatatgccagcgttctgcca
gctggagtagcgggcagaggacggtggccaggggctcacgccacgatgtcacccacatcc
ggggacaaggaccatgggctggggcgagaggttccctcctcctccctggactgggcagag

Predicted peptide sequence(s):


>ADAMTS15_1|GENSCAN_predicted_peptide_1|1158_aa
MLLLGILTLAFAGRTAGGSEPEREVVVPIRLDPDINGRRYYWRGPEDSGDQGLIFQITAF
QEDFYLHLTPDAQFLAPAFSTEHLGVPLQGLTGGSSDLRRCFYSGDVNAEPDSFAAVSLC
GGLRGAFGYRGAEYVISPLPNASAPAAQRNSQGAHLLQRRGVPGGPSGDPTSRCGVASGW
NPAILRALDPYKPRRAGFGESRSRRRSGRAKRFVSIPRYVETLVVADESMVKFHGADLEH
YLLTLLATAARLYRHPSILNPINIVVVKVLLLRDRDSGPKVTGNAALTLRNFCAWQKKLN
KVSDKHPEYWDTAILFTRQRSKSPLYRAMPPSLNLVDLFRLQLCGVSRESPLPRSAERRL
TCIWAIGGEPALSEGVGLARPISASWIRRRGAGTQEVAAPELQFVSKTDRRRREDGVGEG
GNGPPLLYGRLSLLGHLLRSPFKGCRTEGDPRCGSNPKLFYKKGQLENNSPGGLRFLAKM
IPGSSGKVAAATKKNSQLLGIVRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPS
AFTTAHELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRANPWSACSAAIITDFL
DSGHGDCLLDQPSKPISLPEDLPGASYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAK
GQMVCQTRHFPWADGTSCGEGKLCLKGACVERHNLNKHRALTDIISPKQLLLRLPNGLHT
TKVDGSWAKWDPYGPCSRTCGGGVQLARRQCTNPTPANGGKYCEGVRVKYRSCNLEPCPS
SASGKSFREEQCEAFNGYNHSTNRLTLAVAWVPKYSGVSPRDKCKLICRANGTGYFYVLA
PKVVDGTLCSPDSTSVCVQGKCIKAGCDGNLGSKKRFDKCGVCGGDNKSCKKVTGLFTKP
MHGYNFVVAIPAGASSIDIRQRGYKGLIGDDNYLALKNSQGKYLLNGHFVVSAVERDLVV
KGSLLRYSGTGTAVESLQASRPILEPLTVEVLSVGKMTPPRVRYSFYLPKEPREDKSSHP
KDPRGPSVLHNSVLSLSNQVEQPDDRPPARWVAGSWGPCSASCGSGLQKRAVDCRGSAGQ
RTVPACDAAHRPVETQACGEPCPTWELSAWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQ
CNLHRKPQELDFCVLRPC