GENSCAN 1.0	Date run: 14-Jan-104	Time: 23:58:53

Sequence ABCC8_1 : 86416 bp : 50.10% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1327   1474  148  0  1  111   97   367 0.960  40.15
ccgcaggtggtggagcagggcggggtgagggagggggaggccagcggggctgggcggggc
ccggggggcgggggcctgacggccgggccgggcggcggagctgcaagggacagaggcgcg
gcaggcgcgcggagccagcggagccagctgagcccgagcccagcccgcgcccgcgccgcc
ATGCCCCTGGCCTTCTGCGGCAGCGAGAACCACTCGGCCGCCTACCGGGTGGACCAGGGG
GTCCTCAACAACGGCTGCTTTGTGGACGCGCTCAACGTGGTGCCGCACGTCTTCCTACTC
TTCATCACCTTCCCCATCCTCTTCATTG
gtgagtgcgcgcagcgagccgcggaggaggggacgggagagcagggagggaggaggaggc
gctgcgcgccgcaccgctcggcgtccccttccggcccgcgaccgccgtccgcctcgttcc
cggggtcccctgccctgtgtcctgcccgccggtccccgcactcgcacaccagctcatccc

 1.02 Intr +   3076   3217  142  2  1  130   92   103 0.981  14.31
agcataggaccaggctgaatgagttggacgtttagtttgtgtgtaccagccttggggatc
ctcatgtgtaggtgtcaccctcaccatggacccaatgcccaagcacctttctggggttca
tgcaccctcttcctcctccaagtgggcaggcatcctgcctctgactgtctctccctgcag
GATGGGGAAGTCAGAGCTCCAAGGTGCACATCCACCACAGCACATGGCTTCATTTCCCTG
GGCACAACCTGCGGTGGATCCTGACCTTCATGCTGCTCTTCGTCCTGGTGTGTGAGATTG
CAGAGGGCATCCTGTCTGATGG
gtgagtgactgtctgaggactcaggaaagtgaatctgctccagggtacttcctgaaaggc
ccaaggagatcctagctcacctatattccacaagcccatgtcttttgttactacatccag
cagctcagtgtcttctatgtgccaacctctctgagctgggcactggacgcaagtgagtcc

 1.03 Intr +   7881   8002  122  0  2  108   74   128 0.809  13.54
catgtactggcagctctgcccagcccataccccaaatacgcccattaactaaagggccct
gcagcctataaagtgatgctataaaggttcagtgttcagcctttgaaattcaaggcctgg
gctgctctattgcagtacttagcatgtccccatcctgtctgtttctctctcccatctcag
GGTGACCGAATCCCACCATCTGCACCTGTACATGCCAGCCGGGATGGCGTTCATGGCTGC
TGTCACCTCCGTGGTCTACTATCACAACATCGAGACTTCCAACTTCCCCAAGCTGCTAAT
TG
gtaggtgaggtgtaggagggaggggcagtaccttcattcatttcttcagataatgtttac
tgaggactcattatgtgccagctattgctctaaacagtagagatttggaatagaaaaaga
aaaaaatccctgccttcatggagcttacagtctggtgaaggaggatagacaggcaaagac

 1.04 Intr +  14499  14665  167  1  2   89   98   347 0.760  35.48
tgcgtcatcttagagtcatgtactctgatatattcacacgtgcacatccacttactcgga
aatgtacacacccaggcacgcttattctgtctccttctctgccacatacttgcacacatt
atgtgagtgtacacacatgatgcacacacgtctctgcgatcttccatctctcctcggcag
CCCTGCTGGTGTATTGGACCCTGGCCTTCATCACCAAGACCATCAAGTTTGTCAAGTTCT
TGGACCACGCCATCGGCTTCTCGCAGCTACGCTTCTGCCTCACAGGGCTGCTGGTGATCC
TCTATGGGATGCTGCTCCTCGTGGAGGTCAATGTCATCAGGGTGAGG
gtaagcaggccacctgggccagggtggggtgggaagcagaggctctggcctctgtcctgc
cctgggttcaggcccccaccctgcttctcagccaaactgagaagggatcagcttgtttta
cccgcccgtgtaaaggggagtggggccgtggcggaaatttcaggatagacactgcatctg

 1.05 Intr +  16278  16520  243  2  0   81   49   564 0.697  49.49
gacattggtggccaagaagtgttggggaatccttttcctggtaataattacaggcgaaag
atggccccatctgttagagatcaagtgtggaatatcacaaccccagatccttgctggggc
aaggtagggagtggtgagaagttggacttacccatcccccatggcccatgtgccccacag
AGATACATCTTCTTCAAGACACCGAGGGAGGTGAAGCCTCCCGAGGACCTGCAAGACCTG
GGGGTACGCTTCCTGCAGCCCTTCGTGAATCTGCTGTCCAAAGGCACCTACTGGTGGATG
AACGCCTTCATCAAGACTGCCCACAAGAAGCCCATCGACTTGCGAGCCATCGGGAAGCTG
CCCATCGCCATGAGGGCCCTCACCAACTACCAACGGCTCTGCGAGGCCTTTGACGCCCAG
GTG
gtcagtgggggcacagccacaccatctattcactgccttctggtttagggtcacagagag
ggacctcaaagggcattaggtcaaaatcctggtgggacaagaggggaaactgaggctggt
gaggggaagaagcttgccttaagtcacacagtgaaccagggacaggtgcagggctgagga

 1.06 Intr +  17427  17615  189  2  0   80  102   241 0.935  24.48
agggccctcccaactgtgcacttgctgattccatgatctcttcctggagttcacctattt
gcagaggatgtgaccactgggtttccccagacaacaggagctaggggcatcctgggaggc
taggcccagccgtgaattagccctcaggcactctgacctggccatggtctctctgggcag
CGGAAGGACATTCAGGGCACTCAAGGTGCCCGGGCCATCTGGCAGGCACTCAGCCATGCC
TTCGGGAGGCGCCTGGTCCTCAGCAGCACTTTCCGCATCTTGGCCGACCTGCTGGGCTTC
GCCGGGCCACTGTGCATCTTTGGGATCGTGGACCACCTTGGGAAGGAGAACGACGTCTTC
CAGCCCAAG
gtaggcagccccaggggtagggtaaggcaccctctagatggttttcagttgtttctgaga
gtgcaacaggccaatgtgtgtgagccatggccacactggagtggctcctcacacatgcgc
aaagcccatagcagtatccccaccacagaatactctacatctggtcaacagaaatgccag

 1.07 Intr +  24820  24984  165  0  0  108   80    55 0.908   6.86
aaaaacgtttagttggatttatcagtctgatttttcactcataaacaattgcacaagcct
ttgcaagcccagagggtcttgtaataatgatggccgtggtccattatggcacagtgatgt
gttctacggtggtcattttgctggcaatgacagtcacctctgaacttctctttccaacag
ACACAATTTCTCGGGGTTTACTTTGTCTCATCCCAAGAGTTCCTTGCCAATGCCTACGTC
TTAGCTGTGCTTCTGTTCCTTGCCCTCCTACTGCAAAGGACATTTCTGCAAGCATCCTAC
TATGTGGCCATTGAAACTGGAATTAACTTGAGAGGAGCAATACAG
gtacttggatgattattttttcactttgccataagaaccattattaggaataatgtccat
gagtgttattcatcctcatggacactcaagaataattctgctgtaaatttattttttgtt
gcccattaacgatgttttaaaacagtaaccattgacaaggcagtgtgggatagtggaaaa

 1.08 Intr +  29432  29587  156  1  0   98   79    95 0.833   9.81
ttgctgtgctggagtagactagtaagttggaacggtgatacagtaccaccttacagagct
gctctagggcaccatggggactgtctgagaagcccctggcacactgtaacaggtggcatc
tggtgtggtgatgatgatgagaatgatgatgaatgtgaaacactctgctctcatttctag
ACCAAGATTTACAATAAAATTATGCACCTGTCCACCTCCAACCTGTCCATGGGAGAAATG
ACTGCTGGACAGATCTGTAATCTGGTTGCCATCGACACCAATCAGCTCATGTGGTTTTTC
TTCTTGTGCCCAAACCTCTGGGCTATGCCAGTACAG
gtactagatgggctgaggggaagggaggggggcagcaggacacacaaccagaatctgctg
gtccatggccagtaactaggagcacaccgtcttccactccatgcttgcctgtacctttca
cacacttggctataccacaggctgtacctctgggtccctcctgtcccatactctgcaagc

 1.09 Intr +  34791  34925  135  2  0   63  105   128 0.990  12.76
tccttttgaaattgctttgtttctcctccttccctgcactccactccccaagataatttg
gaaacctgggcaccaaggcttgtcccactctaggggactggggaaacagggattttgcca
gcacctcctggcagggcaaccatcaggtcaaagggacctgacccatgaccccttcctcag
ATCATTGTGGGTGTGATTCTCCTCTACTACATACTCGGAGTCAGTGCCTTAATTGGAGCA
GCTGTCATCATTCTACTGGCTCCTGTCCAGTACTTCGTGGCCACCAAGCTGTCTCAGGCC
CAGCGGAGCACACTG
gtgagtgcccaaaggtgtgtgtgttttgtccctcttcccctccttccctcgacagcagca
ggtctcctcccacacacccacactgtcattgactttgactttgactttgagtaggccact
tcacctgtccaggcctcagcttctttgtctgggaaatggagtcaatgggggaggaggctg

 1.10 Intr +  35221  35453  233  0  2   58   94   373 0.790  31.47
ccacttcacctgtccaggcctcagcttctttgtctgggaaatggagtcaatgggggagga
ggctgcctcccggtgaggacaggaggcgggcatggcagtgacagtattgacactcaggcc
ttcctctcgggtgggagacggagcagaagcctctcccctctgactcggggacccctgcag
GAGTATTCCAATGAGCGGCTGAAGCAGACCAACGAGATGCTCCGCGGCATCAAGCTGCTG
AAGCTGTACGCCTGGGAGAACATCTTCCGCACGCGGGTGGAGACGACCCGCAGGAAGGAG
ATGACCAGCCTCAGGGCCTTTGCCATCTATACCTCCATCTCCAGTGAGTTCACCCCACAC
AGCCAGCCCTGGGTGCTGCTGCGTACATGCAAGGAGAGGGTGTCAGAGCTCGG
gtaagagggggtgcagggacagaagcaggaggccttgagattatccgactcagtagggga
gcctcaaactggctctgatagctaagctcccagaaatcaaagtactcttcattcatttat
ccaacaaacatgcatggaaagcctgctatgtgctggacactgtgctggccctcaggatac

 1.11 Intr +  40578  40663   86  0  2  102   72   -10 0.586  -1.74
gcacccatcaattaaggaggtaaagatcagtctgactgagatgcctcctgccacacttcc
tcagctgccagcaactgacaccattaacctgatttccttccccctctgttgactgcactg
actattggactgaatgggaaacagccccgtgcacctcaaaatgcacttcccctcctgcag
ATGCATCTTGCAATTAGGCCCAAACTGTGAGCCTGCATGCTCCTCCCCTGGCCCTGCACA
GGCAACAAAGCTGAAGTTAATCAGAG
gtacaaatggctggctatgcctctctgacacgtaacttctggaacatgtatcaatgcttt
ggaaatgaaaagctcctggtattgcaatgccaggctggtgcccataagggccagaaaaca
ttccttgggcaaagccagggggagtgggtgatctgatcccagctcaggtttgttgatttg

 1.12 Intr +  45859  45899   41  2  2  108   92    64 0.992   6.74
gagggaaatggggtgaggaactggaagtgccacagggctagagttctgcccctagcctac
tggagctgtgccccacaggctggccccactggactgcgctgcctccaagccatcctgggc
atctccatgtgtagctgtcacgctcctcccactaaacgcctccctgtgcttcctctgcag
TTTTCATGAACACGGCCATCCCCATTGCAGCTGTCCTCATA
gtaagtggatcctttctccatctcttgggggtagggtggagggggagggcgtctgcagtg
acaggctgcccagatttggcctttctgcacaggggcctcagaagacaggctccacagcca
gactgaaaataggatcgaaagtttatagagggtgtggcccctccccaactccagccgaac

 1.13 Intr +  47144  47289  146  1  2  108   78   237 0.961  23.78
tgttggggacgtttccatgagatgactgtggggatgatgaaggtgtctccaactaaaaga
tcctcttaggagcctgctccctgacagccctctcatttcccttccagtgctgagcgtttc
cagtgtgggagggacccacaccctgggccaccctggcctcacttgtgcctctgtccacag
ACTTTCGTGGGCCACGTCAGCTTCTTCAAAGAGGCCGACTTCTCGCCCTCCGTGGCCTTT
GCCTCCCTCTCCCTCTTCCATATCTTGGTCACACCGCTGTTCCTGCTGTCCAGTGTGGTC
CGATCTACCGTCAAAGCTCTAGTGAG
gtgaggggagggtccgggcgagggcactgggcaggcaggtcctgtgtcagcctcaaggct
tgctcgagtgatggccaaaccacagctgtttggtcccggaacacacccccattgctgggc
cttgctgtagctggtcctggttggtcagagggacattggcctgtatggtttcccagctcg

 1.14 Intr +  49433  49538  106  2  1   32   89    95 0.798   4.22
aaaccctggtaacaccaattacctgcccccatgcccactggtctgcccccttcagtgtgg
gctttgtgggactatacttcaggcctgagatcctgctcagagctctctatcaggctgcgc
cctctcccctcccctctgcccctggcaggggtgaggggtgtctctgtgcttcccgagcag
CGTGCAAAAGCTAAGCGAGTTCCTGTCCAGTGCAGAGATCCGTGAGGAGCAGTGTGCCCC
CCATGAGCCCACACCTCAGGGCCCAGCCAGCAAGTACCAGGCGGTG
gtgagtgcccggcctccccttgctactcccagcatggtcctctaaggcccaaaacttggg
cctgctgtgtcggacttctgccttttttcccaggaagaggggctcccttccctacacagc
tcccagcccagtgggtcctcacctccaaaccacccccagcccctcagggttgtgaaccgc

 1.15 Intr +  49632  49814  183  2  0   99  109    71 0.492  10.28
ttcctgtccagtgcagagatccgtgaggagcagtgtgccccccatgagcccacacctcag
ggcccagccagcaagtaccaggcggtggtgagtgcccggcctccccttgctactcccagc
atggtcctctaaggcccaaaacttgggcctgctgtgtcggacttctgccttttttcccag
GAAGAGGGGCTCCCTTCCCTACACAGCTCCCAGCCCAGTGGGTCCTCACCTCCAAACCAC
CCCCAGCCCCTCAGGGTTGTGAACCGCAAGCGTCCAGCCCGGGAGGATTGTCGGGGCCTC
ACCGGCCCACTGCAGAGCCTGGTCCCCAGTGCAGATGGCGATGCTGACAACTGCTGTGTC
CAG
gtgagtcctgctgccccatgcctggccacccagcaccaactcccagagggagctcagcac
ctggaaagccagaaagctgcatgcttagtcctctgcagaggtcaccctgcctgcctgtac
ggtccataggagtccagaaaccagggaccaccaagtggggggacccccagccttaggcaa

 1.16 Intr +  50161  50236   76  0  1  -57   64   109 0.567  -6.91
ccagccttaggcaagggtcagcatgagaaggccagtctcccactcccctgctctggaagt
gatccaggggctggaatcagtgtcttttggctttcatggaggaggggaagccagagacta
ttcactgggaactggctgcctttctgttctctcctgggcggtgggacacgcctaatgaag
ATCATGGGAGGCTACTTCACGTGGACCCCAGATGGAATCCCCACACTGTCCAACATCACC
ATTCGTATCCCCCGAG
gtatggcccagtccacccctccagcatgcccctccccatgtcccactgaataacatagag
ataaaaagacaaagctgcatttattgagcacctactctctgctcattcttggtgtatgcc
ctgggtatattatagaaggggaaggctacattctagaggcttccgtgtgctgggtgggag

 1.17 Intr +  50949  51054  106  1  1  134   90    80 0.251  12.07
gaggatgttgatttccagaaggaaaggattaaagagggagaggacttgctggggattcta
ggtaggaagaaagaaaacaggggccccagggttgggtgcatctgtctgtctgtctttctg
ggtaatggttgttcagactcccccggccccactcacatctgccaccctccctccctgcag
GCCAGCTGACTATGATCGTGGGGCAGGTGGGCTGCGGCAAGTCCTCGCTCCTTCTAGCCG
CACTGGGGGAGATGCAGAAGGTCTCAGGGGCTGTCTTCTGGAGCAG
gtaatacatgtatcctcagggcccagtggaggggaaatctccttttaaccatcctcctca
gttgaggatgcacacacatttattggagggcccactctgtgttcagtgaggactcaataa
atgctgctaatggatattctcatcatcatcactagtacgtattcacctcttactatgcgc

 1.18 Intr +  62764  62799   36  1  0   92   84    42 0.734   1.58
cttccccaagatgggcacaccccactctccacacctctctatgcagcatttgtggctaca
gactgggtccaggggattgtaaaggcatgctcatgttgggttggagggagctcaggatct
tcctggaggatatggttcactcccatgagagctcagtatgcctttcctcccctgctgcag
CCCAGAGCGGGAGACAGCGACCGACTTGGATATCAG
gtactgcgtcctgggaacattgccccccagggtcaactccctccagggtgctctcaggcc
caagggagccacatcaccctgctgggcagcccccagaccccagccccagtgttgggggag
gccagggagggcccctgtgctccaccaggtggctcgggagctgctgctgtttctgtgcat

 1.19 Intr +  63493  63591   99  1  0  101   50   131 0.996   9.83
gacctctcaaacctgcctgggggaaggcaaggccaccagaggccacactaagcagatttc
taccaactgcacctccccatccccttgcctccatctgagccatcagcttgacaactgcct
ctgagaacaagcccctgagaatgccttccgcaccccctactcccgccctgctttttccag
GAAGAGAGGCCCCGTGGCCTATGCTTCGCAGAAACCATGGCTGCTAAATGCCACTGTGGA
GGAGAACATCATCTTTGAGAGTCCCTTCAACAAACAACG
gtaaaagcctgtcggagggaggcaggatgtggaggggaggaactgtctctggccagcctg
ccccagttccgggcccctccatcgatcacccacacccagccatctcactccccaggtgct
tacctgcactccagcctctccatatggtgcacctggagaggggccaggtgtgcctgagca

 1.20 Intr +  64625  64709   85  2  1   76   48   149 0.997   9.52
aagtgctgacctcagctcttttcaagctcacacggtgtttgcttgcacccaagcgggagg
cctattaaagccattgctcaccctgggcatagctacccagagactaatgaccctctgcaa
gtgctcgggccaactctgaccaggctgaccagctgcatcccctgcctctacccacgccag
GTACAAGATGGTCATTGAAGCCTGCTCTCTGCAGCCAGACATCGACATCCTGCCCCATGG
AGACCAGACCCAGATTGGGGAACGG
gttagtagcagcctctgaggggttttttcaaagccaggacccccaacctaccatgccctg
agacactactcaggacaatgggtaactaggaaataggagacattgaaggctgaagagttg
cctgcagtaaggtcaaacatgttgttcttgatgatgtcctttgacaggttttcagtcctg

 1.21 Intr +  65357  65437   81  1  0   89   97   147 0.999  15.53
gccctcttctgaatgaattcagtaaacacgtgcaagttccttctctatgcaaggtgagaa
gcaggcaaagaagtggatagagccaggcctccatcccaaagagctcatagtccagtaggg
tacaggacagtgtctcctgaatggctgagggcatgatgtgttcctcctctttggtgacag
GGCATCAACCTGTCTGGTGGTCAACGCCAGCGAATCAGTGTGGCCCGAGCCCTCTACCAG
CACGCCAACGTTGTCTTCTTG
gtgagtgcaagttcccttggggtcctggtctctggctgcctcccaggcctaactgcccac
ctccacctccccgcaaccccaccatcatccaacaatctccctctccaggagtaaatccct
cctgccagagatattgccttatcatcctagtgatagggaaactgaggcaggcaaggatag

 1.22 Intr +  67450  67587  138  0  0  119   68   168 0.988  18.56
attttaaatgaggtaaccaaggcccagagaggttgggtgagttgtccaaagccacacagc
taactagcttcagtccctagagcagagttgatagaactctaatgggttttatactcattg
tcacccctccccaccatgcctttccctaccctctactctcttcctctcccttctgcccag
GATGACCCCTTCTCAGCTCTGGATATCCATCTGAGTGACCACTTAATGCAGGCCGGCATC
CTTGAGCTGCTCCGGGACGACAAGAGGACAGTGGTCTTAGTGACCCACAAGCTACAGTAC
CTGCCCCATGCAGACTGG
gtgagggggaacaagggggtcaggctatagggggcagggctggggaggctgtcaggcatc
ttggcaggaaccaatccgttgtcttggtagcaactgctgagggccacaaagcataagaga
ccagcactggatggctttatgcatgctgggcatttcagggagaccctgtacaggccaggg

 1.23 Intr +  69586  69711  126  0  0  104   98   218 0.987  25.28
taggagtatgttggttggggtaggttatcaataccagcccacttgcagtggatgagctgg
tggccatttgtagtgaggaaagggatgtgtcaacctccatcttagactccacaattgagg
gatgtgaccaccattcctccccagccagcccccaaaccacgtttgttgctgcctttccag
ATCATTGCCATGAAGGATGGCACCATCCAGAGGGAGGGTACCCTCAAGGACTTCCAGAGG
TCTGAATGCCAGCTCTTTGAGCACTGGAAGACCCTCATGAACCGACAGGACCAAGAGCTG
GAGAAG
gtgggtatatccagggatggccaagcagccacccctggatgcaaaggttctgctagaacc
tgaactcataaaggtcttcctgtccttagtgccccaggaagccccctaaagggcagatgt
gggagctgggcatgaactggctcctaccagaggagagacagtacctgtgccaggtgccca

 1.24 Intr +  70650  70749  100  2  1   52   87    74 0.834   3.38
tgatgaaggggaaggactaaatcctggcaagatgaatgtgtgtctgtctgcccctccctc
aggcagggacaaagtagaaatctgacattggtcatcaccagagtagttaccccttaactt
ccccttcccccaccaaccatatatcctgaagacattgcccaggccacatctgtcttttag
GAGACTGTCACAGAGAGAAAAGCCACAGAGCCACCCCAGGGCCTATCTCGTGCCATGTCC
TCGAGGGATGGCCTTCTGCAGGATGAGGAAGAGGAGGAAG
gtacaggcaatgggactgggagtgaaattatggcctgaggtctgatcagccacagagagg
ctaaggtttggggttctgggtgtggtgcagtagtgtgcctttgattaaatggcttccctc
tgtgtgcccccgttgtcccctcagtaagtggggataaaatgccctgattcaccctcagag

 1.25 Intr +  70974  71215  242  1  2   19   64   418 0.945  29.77
atcagccacagagaggctaaggtttggggttctgggtgtggtgcagtagtgtgcctttga
ttaaatggcttccctctgtgtgcccccgttgtcccctcagtaagtggggataaaatgccc
tgattcaccctcagagggatggaaatgtgtagccacagagtgggttcttgcggcctgcag
AGGAGGCAGCTGAGAGCGAGGAGGATGACAACCTGTCGTCCATGCTGCACCAGCGTGCTG
AGATCCCATGGCGAGCCTGCGCCAAGTACCTGTCCTCCGCCGGCATCCTGCTCCTGTCGT
TGCTGGTCTTCTCACAGCTGCTCAAGCACATGGTCCTGGTGGCCATCGACTACTGGCTGG
CCAAGTGGACCGACAGCGCCCTGACCCTGACCCCTGCAGCCAGGAACTGCTCCCTCAGCC
AG
gtgtgactggcggcccatggcagaggttgggagtggggatgggggaagggctgagcccat
gggcaccctggaactccaaatcactctctgcctgtgaaggagtgcaccctcgaccagact
gtctatgccatggtgttcacggtgctctgcagcctgggcattgtgctgtgcctcgtcacg

 1.26 Intr +  71315  71481  167  1  2   20   65   185 0.895   8.16
gccatcgactactggctggccaagtggaccgacagcgccctgaccctgacccctgcagcc
aggaactgctccctcagccaggtgtgactggcggcccatggcagaggttgggagtgggga
tgggggaagggctgagcccatgggcaccctggaactccaaatcactctctgcctgtgaag
GAGTGCACCCTCGACCAGACTGTCTATGCCATGGTGTTCACGGTGCTCTGCAGCCTGGGC
ATTGTGCTGTGCCTCGTCACGTCTGTCACTGTGGAGTGGACAGGGCTGAAGGTGGCCAAG
AGACTGCACCGCAGCCTGCTAAACCGGATCATCCTAGCCCCCATGAG
gtacccgtctcccctggccaggctgggactgtgagcaagtcactgttctctgagccttag
tcttcccatctataaaatggggatatacaacctgtcacaagcttgtgggggtgactcaag
gagacagtgtgtgtaaaagtgccctccttgtgcaagaagcagggagaaactggcatttac

 1.27 Intr +  72540  72609   70  0  1   91   92    73 0.995   7.18
ccctttgggcagctgcaggaattcacggggatacaggccagatgtctacaaattggcaga
ggatgccagacccatgaatgactccagagacacttacatgaaataattaactatctcatt
cagtaaacaggaagtaaatcaatggacaaatgagtaactcttcctctggctgcctcttag
GTTTTTTGAGACCACGCCCCTTGGGAGCATCCTGAACAGATTTTCATCTGACTGTAACAC
CATCGACCAG
gtacagaggaccgtgccacactatccccccttccagagacacctcggacccctgggggct
tctcctgtctgaggctgggttccccagatcaggtgatcacagccctctgggaagaagcca
gtgtccccgatccgattataatgctgcttcagggctggggcctccctcgtgggagcctca

 1.28 Intr +  73434  73591  158  2  2  119   64   243 0.997  23.81
gcagaggctgccgtgaaccgagattacgctgctgcactcaagtctgggcaacagtgagac
tcagtctcaaaaaaataaaggatcaaaaaataaagtgagagcaaaacatggcggccagta
gcactctaaacacagtcaataccaaaattcacctcactctctccccctcgtctccctcag
CACATCCCATCCACGCTGGAGTGCCTGAGCCGCTCCACCCTGCTCTGTGTCTCAGCCCTG
GCCGTCATCTCCTATGTCACACCTGTGTTCCTCGTGGCCCTCTTGCCCCTGGCCATCGTG
TGCTACTTCATCCAGAAGTACTTCCGGGTGGCGTCCAG
gtgatggcctcaggggtgaggggtgggaggtgctttgcaatgtgcagtttggtgtacttg
ctagactcatcgttatgagagtaatagggtcgtgttccctccaaaaaataaaaacaaaaa
acagaaatgaaggaaatagaaatatccacatcttattccaccgccctaatataatagtct

 1.29 Intr +  75350  75465  116  2  2  133   97   165 0.999  21.99
gtgctcacaaaagctcaatgggctggtggcattgtcttcccccttcacggggtaagaagc
tgaggcctagagaggtaaggccattcacccacacagcggtagcaggtggagctaggcttc
aggcccaggccgagccctgagcctgccctcttaactgttccactctgttccccgccacag
GGACCTGCAGCAGCTGGATGACACCACCCAGCTTCCACTTCTCTCACACTTTGCCGAAAC
CGTAGAAGGACTCACCACCATCCGGGCCTTCAGGTACGAGTCCACATTCCCCCAAG
gtaggagtggaacaggggtggggccagggggcacaggccatgagatttgattctcaggac
tccacttgggaaggccaaggacacgttctctctcaagctgcctcaggtcccaaggcccaa
gggatatccaccagcagggacaggccaggtgggctcccactgaatgttctagagaggaaa

 1.30 Intr +  77952  78145  194  1  2  106   47    78 0.622   4.71
gccctgatgcacacacattttcaacacgcacttactctacccttcaggcatggtttcaca
ctcactgcagacacgtcaccctcccacacgtctccaccctgggggtgtgcagtagcatgc
tctctcccacctcagaacctcccttcagtcccctcagacacatgccctctctccacgcag
AGACAATCAAAGCTGAACTAACACCTTCCAGGGTGAAAAGCAAATGCCCAGTAAGGTACG
TCTTGGGTGCCTCCGTGTCCCCTGAGTTTGGTCCTATCAAACCAGCGATGATGAGGCAGC
TTTTCTTTCGTTCCTTCCTCCATCATCAAACAAGTGCTCCTGCATCTCCTCTGGGCCGGG
CCTACGTCAGCAAG
gtctgagggaagcggccaaggagagtgatgacggcagcccaggttgatcagagaaaggag
gcaggtccatgcgcagtaactcagggaaaacatgatgaggacctaaggatgagaaagaag
cctccagagttccctgtgcagagagattccatcaatttcagagggtcaggggagtgccat

 1.31 Intr +  80306  80419  114  1  0   91   89   137 0.994  14.74
gttggctcctggggctccagccttcgcagcccttgtgtgtgtctggtgacgtgtgcatga
gttgcagggctggagtggaggcctggctgagctgctctctgccccgaaaaggagtgaggt
agaacaggggcctgtggctctaacccctgagcgcccaggtcagctcctctccctccccag
GAGTACATCGGTGCATGTGTGGTGCTCATCGCAGCGGTGACCTCCATCTCCAACTCCCTG
CACAGGGAGCTCTCTGCTGGCCTGGTGGGCCTGGGCCTTACCTACGCCCTAATG
gtgagcggcagtgggctagggcagaggaggggtcagacaccagcactcccggagcacctt
cgtcactggagacatgagacactcccaggccttaccccaatttcatttgcatctgatgcc
agagggacagtgcgggcaggaaggctgaccagcaggccccagggcccaggccccagacag

 1.32 Intr +  80790  80910  121  2  1   89   72   200 0.976  18.57
gggagccacatgactgaccctccctgtgcctccagggagggctgctctgagcaggcagtg
gatggcagcaaaaggaatctggggccctggcccctctccagccttaagaagagccattct
ggtggctgaggacagaactaagcgaccatggagtgtgcgccactggcttgctccccacag
GTCTCCAACTACCTCAACTGGATGGTGAGGAACCTGGCAGACATGGAGCTCCAGCTGGGG
GCTGTGAAGCGCATCCATGGGCTCCTGAAAACCGAGGCAGAGAGCTACGAGGGGCTCCTG
G
gtgagaggctcagggagaggggtggggaagagtccaaggaggagtgtgtctgggttgggg
gccacaagggagcctggggatggggtggcactttcggatactagctgtggcccatgcctg
gtggctgagcccagcccggcccccagcaccatcgctgatcccaaagaactggccagacca

 1.33 Intr +  81057  81187  131  1  2   13   77   333 0.835  25.11
aaaaccgaggcagagagctacgaggggctcctgggtgagaggctcagggagaggggtggg
gaagagtccaaggaggagtgtgtctgggttgggggccacaagggagcctggggatggggt
ggcactttcggatactagctgtggcccatgcctggtggctgagcccagcccggcccccag
CACCATCGCTGATCCCAAAGAACTGGCCAGACCAAGGGAAGATCCAGATCCAGAACCTGA
GCGTGCGCTACGACAGCTCCCTGAAGCCGGTGCTGAAGCACGTCAATGCCCTCATCGCCC
CTGGACAGAAG
gtcagagcacgggcccaacccaatgctgcaggacaggcgtgagcaggggatggggcatgc
acggagctggatggcttcgcagtcacctcgtggccctccagggccgaggcctctcactat
tcagacatcgcagtctcctgccctgggcctgtgggggcccatctttcctctccttctatt

 1.34 Intr +  82173  82251   79  2  1   98  113   121 0.999  14.72
ctggacccactgcaggaaacaagcccaaacctgtggtgtccaaagagaaactagtcagaa
aaccaggccaaaaagataccctgtgacctcccacacctgcacacacacccagagctagca
tagaggctattcccagcagccccagagtcccagtggcggtgcctgcttctctctttccag
ATCGGGATCTGCGGCCGCACCGGCAGTGGGAAGTCCTCCTTCTCTCTTGCCTTCTTCCGC
ATGGTGGACACGTTCGAAG
gtgagttgtaaggcgggcaccccacgtgtacccacagccaccagatgaggcctcagccct
ggcacgtggtcagacatgacaggaggcccagcagtcaccgccttcccctgcaccctcact
gggacccatgcagggcacatcatcattgatggcattgacatcgccaaactgccgctgcac

 1.35 Intr +  82385  82493  109  0  1   38  105   244 0.811  20.44
gtcctccttctctcttgccttcttccgcatggtggacacgttcgaaggtgagttgtaagg
cgggcaccccacgtgtacccacagccaccagatgaggcctcagccctggcacgtggtcag
acatgacaggaggcccagcagtcaccgccttcccctgcaccctcactgggacccatgcag
GGCACATCATCATTGATGGCATTGACATCGCCAAACTGCCGCTGCACACCCTGCGCTCAC
GCCTCTCCATCATCCTGCAGGACCCCGTCCTCTTCAGCGGCACCATCCG
gtgagccccaccacccctcaggcccacccagccccaggccggctcagttccatcagatct
ggagcacaaagaggagggggttgggggagaccaggatcccagaggtgtttcctgctcatg
cccttctccatcccatcaggcccaggcagcctctggaaggggatcccccacccatgggtc

 1.36 Intr +  82828  82981  154  1  1   77   67   104 0.733   7.27
ggaaggggatcccccacccatgggtctaagatgctgtcccccacccactgccaccacctc
ggtgcttctcccagccagacctccaactcagtctgctctcgctcactgccctctttgccg
cctggggatgcaggcaggaccctgctccctccctactggggctttctgtgccacttccag
ATTTAACCTGGACCCTGAGAGGAAGTGCTCAGATAGCACACTGTGGGAGGCCCTGGAAAT
CGCCCAGCTGAAGCTGGTGGTGAAGGCACTGCCAGGAGGCCTCGGTAACTACTCCTGGCT
ATGCAGCTGGGTTGGTTGGGCACTCAAGGACCCT
gtaaggatggcagacagaagcccgtgtctcaggtttgccccaagtttggagtctgaagcc
tggcaggaccatttagtcctacttctcactatacgggggcccagagaggtcaggtgtctt
gccccaggtcacacaactggtcagttcagggtctggctcctcctgcagggtacagcgggt

 1.37 Intr +  83658  83837  180  2  0   73   24   186 0.646  10.76
gcagcacacacctccaggggtgcccttctcgttgcagtccttgcagacggcctccacatt
gttgtgtcaggtgcaccagccctgcacacgcctgtgctcttggacacacacccacctatt
tgcccccatgcacacattttccaacagccccccaagccatcccatctgctccactcacag
CACAAGATTAACTCAGTCCTACTTCATCTCCCCGGGCTGTTTTCAGATGCCATCATCACA
GAAGGCGGGGAGAATTTCAGCCAGGGACAGAGGCAGCTGTTCTGCCTGGCCCGGGCCTTC
GTGAGGAAGACCAGCATCTTCATCATGGACGAGGCCACGGCTTCCATTGACATGGCCACG

gttggtcctgggcccctccatgggaccatggtcttggaaagggtttagtgggatgctagg
gagaaatttgcacgaagtagtcctgaggctcaagttgcctctaacatcaaatgctatgtg
ttgcagaaaatgaaaagagctggggggaccctgactctgtctagtcttagggaatgttac

 1.38 Intr +  84344  84406   63  1  0   60   91   110 0.985   7.41
caacaggctgagtccagtccctgagtgccgggaacctgttcagtcctgtggggtgggggt
gggactaggatcggggtcagatgggagctgagccacagacctgggctccacatcccccaa
gccaggccagaccccatccactgggcaggtgagccaacagctgttgcccccacttggcag
GAAAACATCCTCCAAAAGGTGGTGATGACAGCCTTCGCAGACCGCACTGTGGTCACCATC
GCG
gtaaggggcccattgatggggtgcagagggacacccagggacaggactggcctgttgtgg
ccgtcatcagtgcacagcccctgggcttgcctggtcccagtaatcaagaaagaaccctga
agcaggcagttcagggcaaggggcctggagggcatgcagggagcctgggttgcaggattt

 1.39 Term +  84975  85112  138  2  0   83   43   263 0.993  19.26
gcagatggagagcttgtagtcacatccaccccaggaaagtgcagtccccacagtgacagg
acattctggccacatgcctcatcctcctcctccaagccgcaggagggccaccctcagctg
tggcccccaccgcgggtggtattcccaccatcctgacccgccccctcctgccctgcccag
CATCGAGTGCACACCATCCTGAGTGCAGACCTGGTGATCGTCCTGAAGCGGGGTGCCATC
CTTGAGTTCGATAAGCCAGAGAAGCTGCTCAGCCGGAAGGACAGCGTCTTCGCCTCCTTC
GTCCGTGCAGACAAGTGA
cctgccagagcccaagtgccatcccacattcggaccctgcccatacccctgcctgggttt
tctaactgtaaatcacttgtaaataaatagatttgattatttcctactagaggccctaag
tctggtgggcaggggctggcggtggatggtgggttcagtagaaccagcctggctctgaca

Predicted peptide sequence(s):


>ABCC8_1|GENSCAN_predicted_peptide_1|1714_aa
MPLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHI
HHSTWLHFPGHNLRWILTFMLLFVLVCEIAEGILSDGVTESHHLHLYMPAGMAFMAAVTS
VVYYHNIETSNFPKLLIALLVYWTLAFITKTIKFVKFLDHAIGFSQLRFCLTGLLVILYG
MLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCEAFDAQVRKDIQGTQGARAIWQALSHAFGRRLV
LSSTFRILADLLGFAGPLCIFGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAYVLAV
LLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIMHLSTSNLSMGEMTAGQICNL
VAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFRTRVETTRRKEMTSLRAFAIYT
SISSEFTPHSQPWVLLRTCKERVSELGCILQLGPNCEPACSSPGPAQATKLKLIRVFMNT
AIPIAAVLITFVGHVSFFKEADFSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQ
KLSEFLSSAEIREEQCAPHEPTPQGPASKYQAVEEGLPSLHSSQPSGSSPPNHPQPLRVV
NRKRPAREDCRGLTGPLQSLVPSADGDADNCCVQIMGGYFTWTPDGIPTLSNITIRIPRG
QLTMIVGQVGCGKSSLLLAALGEMQKVSGAVFWSSPERETATDLDIRKRGPVAYASQKPW
LLNATVEENIIFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRI
SVARALYQHANVVFLDDPFSALDIHLSDHLMQAGILELLRDDKRTVVLVTHKLQYLPHAD
WIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKATEPPQGLSR
AMSSRDGLLQDEEEEEEEAAESEEDDNLSSMLHQRAEIPWRACAKYLSSAGILLLSLLVF
SQLLKHMVLVAIDYWLAKWTDSALTLTPAARNCSLSQECTLDQTVYAMVFTVLCSLGIVL
CLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSILNRFSSDCNTIDQHIPS
TLECLSRSTLLCVSALAVISYVTPVFLVALLPLAIVCYFIQKYFRVASRDLQQLDDTTQL
PLLSHFAETVEGLTTIRAFRYESTFPQETIKAELTPSRVKSKCPVRYVLGASVSPEFGPI
KPAMMRQLFFRSFLHHQTSAPASPLGRAYVSKEYIGACVVLIAAVTSISNSLHRELSAGL
VGLGLTYALMVSNYLNWMVRNLADMELQLGAVKRIHGLLKTEAESYEGLLAPSLIPKNWP
DQGKIQIQNLSVRYDSSLKPVLKHVNALIAPGQKIGICGRTGSGKSSFSLAFFRMVDTFE
GHIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNLDPERKCSDSTLWEALEIAQL
KLVVKALPGGLGNYSWLCSWVGWALKDPHKINSVLLHLPGLFSDAIITEGGENFSQGQRQ
LFCLARAFVRKTSIFIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTILSADL
VIVLKRGAILEFDKPEKLLSRKDSVFASFVRADK