GENSCAN 1.0	Date run: 14-Jan-104	Time: 22:50:11

Sequence SLC18A2_1 : 38608 bp : 46.48% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1714   1834  121  0  1  109   79   317 0.634  33.25
ctcgtggggacgcgctcgaggcaggtgagccgaggctggggcgcccgggggtgtccccgg
atgccggtgcgcgcggctccctgacccgcccttccgcggcctgggggacgggagaatggg
gggtccacggccgccttgggtcctcaccgcgcaccgcgcccgcagcggagccccggagcc
ATGGCCCTGAGCGAGCTGGCGCTGGTCCGCTGGCTGCAGGAGAGCCGCCGCTCGCGGAAG
CTCATCCTGTTCATCGTGTTCCTGGCGCTGCTGCTGGACAACATGCTGCTCACTGTCGTG
G
gtacgtgcggacagggcacccctgccccggcaccccagccccagcgccccttccccggca
ctccacttacccctgcgcggtcccggagctccgccaaggcccgggaaagttggagaactc
gctttgcaaaaaagacatcccctccaggctgccgcgccggggctaggaggagccgcgttg

 1.02 Intr +   3991   4333  343  2  1   76   91   381 0.725  31.69
ggccagcctggtctcgaactcctgacctcaggtgatccacctgcctcagcttcccaaagt
cctggaattacaggtgtgagccactgctccctgccgacacaaccatagttttttgctggc
ttttttcctggagagggtttcagtgtgatcaccaccttgccattctgctcttatccccag
TCCCCATCATCCCAAGTTATCTGTACAGCATTAAGCATGAGAAGAATGCTACAGAAATCC
AGACGGCCAGGCCAGTGCACACTGCCTCCATCTCAGACAGCTTCCAGAGCATCTTCTCCT
ATTATGATAACTCGACTATGGTCACCGGGAATGCTACCAGAGACCTGACACTTCATCAGA
CCGCCACACAGCACATGGTGACCAACGCGTCCGCTGTTCCTTCCGACTGTCCCAGTGAAG
ACAAAGACCTCCTGAATGAAAACGTGCAAGTTGGTCTGTTGTTTGCCTCGAAAGCCACCG
TCCAGCTCATCACCAACCCTTTCATAGGACTACTGACCAACAG
gtagggcagactactttagtcaaagagtttgatatttgtatcagtcctagcttatgtcct
tcctggaattctgcttcttactcattggtgagagtctggaaaatccatggtgggtgagct
ggggaaaacccagtccccttcccctatgtctctgttcccagataaccacaatttcctatt

 1.03 Intr +  13419  13477   59  0  2   89   83    17 0.663  -0.17
cgttccaagacagtcaaacacaaaaaggtcacataggaagcactgagtatatgaattttc
agaaaagtccaccaaacacttatctgtctgatcccaaagggtagccaggcgaaaatcaat
ataaagccttaaaaaaatagcctgcagtcaccagatttgtctgatgtttgtgttttgcag
AATTGGCTATCCAATTCCCATATTTGCGGGATTCTGCATCATGTTTGTCTCAACAATTA
gtaagtgtgtggtgttttccttctgagtgtgggtctcatcagggtgggcattgatgccca
tgagccgggaattaacaatacaacctaaggacggcgggggggcggggggggtcgtggttg
gctcatgcctgtaatccgagcactttgggaggctgaggtgggcggatcatctgaggtcag

 1.04 Intr +  14068  14151   84  2  0   73   82   138 0.574  11.49
aggtttgtgtattggcaacaattgcagaaaggaattgatagctttttacggaacaaaagc
acagggtggctaacatgcaaatgctccactgggttaaggggggcttctgaaacgttcctg
tttgggacggttgtgtcccagcagcactgatgtgcggtcttggaccccctctctcggcag
TGTTTGCCTTCTCCAGCAGCTATGCCTTCCTGCTGATTGCCAGGTCGCTGCAGGGCATCG
GCTCGTCCTGCTCCTCTGTGGCTG
gtaggtgtggaatgcctgagtgagttcgtgaggggccccttgcagagtgagctggactca
ttcagggaattcaggtattggtggtggttggggtgctggggattcttggagaaggcaccc
actttcctcttgggttctgcttggtcttacattttagtgaatctgacaggtttgggaaga

 1.05 Intr +  14425  14517   93  2  0   93   80   100 0.996   9.64
tgctggggattcttggagaaggcacccactttcctcttgggttctgcttggtcttacatt
ttagtgaatctgacaggtttgggaagatcacaaggctggctggagagggaaggcgagtca
cgcattattcttttgctgttccccggagctggcctgttgactatttctttccctgtgtag
GGATGGGCATGCTTGCCAGTGTCTACACAGATGATGAAGAGAGAGGCAACGTCATGGGAA
TCGCCTTGGGAGGCCTGGCCATGGGGGTCTTAG
gtgggtaaggcccccgtgtaggcaaactggcaagaggggcctgcctggtgctggacagcg
gcagtcctcgcccagtgaccctggcgcagtttgcactgacacagaggtcccctttttatt
tttttcctttcctgctttcatggagactttgaaaaatggtaggaagagccctgagctggg

 1.06 Intr +  15297  15386   90  1  0   98  105   132 0.999  15.87
aggcacttggaggaagttgccaagacaactgaactctaaccgaacagaacaatagggcag
ccaccccaaagccttattggaacaaagtagagagagaaacacaagagtcaaatagatggt
tctagtacagggagagggcatgtgtcccaggggtggtgtccccactttctctccctgcag
TGGGCCCCCCCTTCGGGAGTGTGCTCTATGAGTTTGTGGGGAAGACGGCTCCGTTCCTGG
TGCTGGCCGCCCTGGTACTCTTGGATGGAG
gtgagtgagtccacgtgggcgccatgccatgaccttggcatcgtgctggcacgcgcttgg
gccacacctgctttctgaagaggggcttgtcttttttatttttattttttagctattcag
ctctttgtgctccagccgtcccgggtgcagccagaggtaagcggctgggaatgagggccc

 1.07 Intr +  15499  15542   44  2  2   82   99    39 0.995   2.36
gctctatgagtttgtggggaagacggctccgttcctggtgctggccgccctggtactctt
ggatggaggtgagtgagtccacgtgggcgccatgccatgaccttggcatcgtgctggcac
gcgcttgggccacacctgctttctgaagaggggcttgtcttttttatttttattttttag
CTATTCAGCTCTTTGTGCTCCAGCCGTCCCGGGTGCAGCCAGAG
gtaagcggctgggaatgagggccctgggggagggggcatggtgctgcttctgacccgtgt
ttttttcttgacagagtcagaaggggacacccctaaccacgctgctgaaggacccgtaca
tcctcattgctgcaggtggggctctgtgggtcttctgagtcaggggaatgcgaggtgatg

 1.08 Intr +  15617  15677   61  1  1  113   75   114 0.993  10.91
acgcgcttgggccacacctgctttctgaagaggggcttgtcttttttatttttatttttt
agctattcagctctttgtgctccagccgtcccgggtgcagccagaggtaagcggctggga
atgagggccctgggggagggggcatggtgctgcttctgacccgtgtttttttcttgacag
AGTCAGAAGGGGACACCCCTAACCACGCTGCTGAAGGACCCGTACATCCTCATTGCTGCA
G
gtggggctctgtgggtcttctgagtcaggggaatgcgaggtgatggccgcgtgctggagg
caggggtggatggccagggctgattttcgttttgctgctagaaatgttgggctatataaa
aaaacagaaaaggcaaagaggctacaagtcaaaggaaatggttttcttccgccattgctt

 1.09 Intr +  17817  17912   96  1  0   92   82   116 0.946  11.38
cgaccatgatgatgatgattatgataaacagcctttgctgtccccttgatatgcgattta
tcctttacttaatgaaagtagaagttgcggttatctgagctgtaggcgcatggagtctaa
ctgtgcctggaaatgagagaggaggcagaagccactacaaagccctttcctcccttacag
GCTCCATCTGCTTTGCAAACATGGGCATCGCCATGCTGGAGCCAGCCCTGCCCATCTGGA
TGATGGAGACCATGTGTTCCCGAAAGTGGCAGCTGG
gtaaggactggggtgggctcttctgattcaagagcatttgtccccagggcagcctttgtc
cccagggcatccctgctgagttgcccttatggggatgataaagtgattgcttctgtttga
ctcttaatggggtcattgcttagggcagccttggggtctgtttgttctctggtttatcca

 1.10 Intr +  19509  19563   55  1  1  118  103   -46 0.530  -2.06
aaaaattctccaattgcagtcaagtgttggcaaacctgatctttctgtgtatttgctcgt
ttgtggatgtctgtcctaggtcttcagtctagacttccttccccatcaccccagcatctt
ctgtgcctctcttctgtttcctgtattccttgcccttgactgacttcctccttattgcag
AGCATAGCCTCCCACAGCATAGCCTCCCACAGCTTCCTGAGAGTGTGCGTGGCAG
gtaaaggtctctgagaccctgcatagttgcaaatattttacccttatcctacactttgtt
gactttgtctgcatgtataattcttggttggaaatcatttcccttgggagttttcgggcc
actgttctgttgtcttctagcatccagggttgctgtgggggaggccagtgttgccctcat

 1.11 Intr +  21689  21788  100  2  1  104   74    41 0.720   4.41
cgtgtggatagcttcagatggagactctcagctctgaatcaagcagacattttcaatgtc
cccaacccttcttcaggtgaccttattctctcacaggcatccagccctggggaatggggg
tgtcttgccagaagctgccccctggcttagactttccctgttctgcctgcctccctgcag
TTGGGCTGGCCTGAGTACCAGTGTCTTTGGAATCTGCAGAGTTGCTATGCTCTCTCATCG
AACAATACCTAAAAAGTCCCAAATGGCCGGGGGAGAGGGG
gtaaggatggagagaaactgctaatggggtgtgaggtttctttgtgggatggtgacaatg
ttctgtaatcagatggtgatgatggttgctcaactctgtgaatacactaaacatcactga
gcgatgcactgtcaaagggtgaattttgtttttttttgagacggagtctcagtctgttgc

 1.12 Intr +  27693  27756   64  2  1   90  111     1 0.661   0.89
ctttgacttttaaagatttggagggtccggttcttcacaaaccccacccttcttcctcct
gttttcttcagaagggaacaggcataccacgctcagagaaaacacaagttcaagactttc
cgagatgatttagagttggatctcttgttattttagcataatgtttatttcctcttacag
ATTCCATTTGCAAAAAACATTTATGGACTCATAGCTCCGAACTTTGGAGTTGGTTTTGCA
ATTG
gtaagtcacacgaaccttgtgcctacatttaaaaccgcttttccactaggaagggttctt
cttcctctggtagactgtagttcctcaacctaaatttccagaatcttagaaggaggctgc
aggcagcttagctaaattacagcctgtcgattctccgtgtaaagacacctgcttctatgc

 1.13 Intr +  30091  30210  120  2  0   71   82   162 0.762  14.37
cagaaaaggcttccttcattctttctactcaaagattagtatcaccccaagacttgcagg
tggtgatgacagaaggggaagagctggcagggtggtgagtttaagacacactccctgata
ttcggcccattttgggtttacatccgttttctatacactgtgttccctgactgtcttcag
GAATGGTGGATTCGTCAATGATGCCTATCATGGGCTACCTCGTAGACCTGCGGCACGTGT
CCGTCTATGGGAGTGTGTACGCCATTGCGGATGTGGCATTTTGTATGGGGTATGCTATAG

gtaaggacattggcttttcataagaaccttttacctcaatacgtaatggataacgtctac
taaaattgtttaaatctttgcatctttcagtctacaagacatttggaagagctttatcta
attctctgtttcctgaaaggtccttctgctggtggtgctattgcaaaggcaattggattt

 1.14 Intr +  30350  30483  134  0  2   52   95    76 0.998   5.06
cgccattgcggatgtggcattttgtatggggtatgctataggtaaggacattggcttttc
ataagaaccttttacctcaatacgtaatggataacgtctactaaaattgtttaaatcttt
gcatctttcagtctacaagacatttggaagagctttatctaattctctgtttcctgaaag
GTCCTTCTGCTGGTGGTGCTATTGCAAAGGCAATTGGATTTCCATGGCTCATGACAATTA
TTGGGATAATTGATATTCTTTTTGCCCCTCTCTGCTTTTTTCTTCGAAGTCCACCTGCCA
AAGAAGAAAAAATG
gtaagaaaaatttaggatgcagtgagcatttcttgataattttagcatggccttcctgat
agcttcctcatggtttcattctaaagccttcaaacataaatggtgagaattcctttttag
tttgtaccacatagagcagttacttcttttatttttttattactgtgaaagttatttctt

 1.15 Term +  32344  32457  114  0  0   86   42    91 0.949   2.87
aatgaaagaatcccaacagagtgactggccctgtggctcaaaaagtgtgttcctatttcc
aatatcaccccactctttcctgcttatctaactctctggcttcccccgtcagtccagcaa
tacctgaattttctccctttttcctcctctgtgatgtgagagtttccttttgctatacag
ACCCCAGAACTCCTGAATGGGCTCCCCTTGCCAAGCCGGCAAACATCAGTGGCTGTTGTG
ATGTCCGTTTGTGAACGGCAGCCTGATGGCTTATCTGTGGCCTTGGGGAAATGA
atgaggtcagaggatgagcagagaatgtgcttgcccagccaactaccactgtgttccgca
gaaggactggcagaaggcaggcctcagtacccctcctctttccccatttaaacgaatact
tcagttcatgttttaaaaaaatgctgaaggaagtggaagagacgatcctgaaaggccaaa

Predicted peptide sequence(s):


>SLC18A2_1|GENSCAN_predicted_peptide_1|525_aa
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI
QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE
DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS
SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS
VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS
ICFANMGIAMLEPALPIWMMETMCSRKWQLEHSLPQHSLPQLPESVRGSWAGLSTSVFGI
CRVAMLSHRTIPKKSQMAGGEGIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDL
RHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRS
PPAKEEKMTPELLNGLPLPSRQTSVAVVMSVCERQPDGLSVALGK