GENSCAN 1.0	Date run: 14-Jan-104	Time: 23:22:50

Sequence PTER_1 : 78144 bp : 40.99% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    727   1541  815  1  2    8   37   305 0.422   7.55
gaggacgaaggagaggtttgcccttggccccctacaatacctaaaggtatgactctttac
tgtggcagctgctccaagcatcatgttttgccaacagactcacacatactaagtttattt
cagtcacagcaagtaccagggccagttcaagtgctctagcacggcactctaattctaaag
AGAAGGAAACGCGGCACCGGGGCAGGAAACAGTGACAAGTGGGAACACAAAAACCAAAGT
TCTCCGTATGCAGCATGAGGATCCAGAACCCACTGTGACATCAAATTGCCAGAGCACCAC
CTCCGATTTATTCTTGGGGAAAACCAAAAGAGCTACGGAATGCTCCCTTGTTCCAGACTG
TTCTATGGAGAACTGGGATCTGGGGAAAATGCAACAGTTTCTTTCCGTTTGGGGATCTAG
CCCCGAATTTTTTTCATTCAGCCAAACTACCGACAGTCAGACAGCGCCTGCAGGAGGGTG
TGGCCAGGCAAAAACGCGGGGAACGGCCCCGGACCAGGGTGGGGCGTGGCAAGGGTTTGA
AGGGCGTGTCCTACGAAGAGGTAGGGCTTGGCAAGGACCCACGGGGCGTGTCCTAGGACT
CGGTGAGGGCGTGACCTCGGGCCAGGGGCGGGGAGAGAACCAGAGGGCGAAGTGGGAGGG
CACAGGGGAGACTAAAAAGGCCAGGGAAGTTGGCCTGCCGGAAGTTCCCAGGGAGAAGGC
AGCGCGTTGTACCCGAGGTAAGGCTTCTTGGAGTCAGAGCAGGAGCCGGAACTGTGGGCC
CAGTAGGAAGAGTGGGGCCCGACGGCGGAGGCCGCGCGGCCAGGGTTCGCTGCAGAGCTC
CACGCGAGGGTCCTGCCGGAAGGAAGGATTTTCTAGCCGCTGCGCTTGGGCCCTGCCGCC
TCTCCTTAAGTGCTTGAGGGACGTTGCAAAGAGCGCCAGTCCCGTGTGGCGCCAGCTCCC
TGTGGCTCGACAGCAATGCCCGGGGGCGTCATCGG
gtagctgtgctaagcctcctttaataagcttttttttttttttttttttagattcagggt
ctggctctgcttcccaggctagagtgcatttggcgcgatcacagctcactgcagcctcga
cctcctgagctcaagcgaacttcctgcctcagcctcctgagcttcctgagtagctgcgac

 1.02 Term +   9868  10079  212  2  2   34   55   179 0.477   5.67
ccaagagtagctggaagagtatctttcctagttttggcctagattatttgagacattttt
tatttatgcttctctggcatatgacatgtctattacttccatgagtcagtgcctttctcc
cagttagcatttcccaggctctcaggctgcagtgtctccaagctcagtctttgatttcag
AGCCTATTAGCCATGGCACAAATCCGGTGAACACAGAAACTTACAAAGAGGCCACTTGTC
TCCGATGCACTGATGCACCATGCGTGGCTAGTGCCTTCTGCCCAATGTCTTCTCTGAAAA
CATTCCCTGCTGTTGTAGGAAGGATCCTACAGGCTGACACCAAGGAAGCCATGCTGTCTC
CTGGGTGGTCTTCAGAGGACACTGCCTCCTGA
ggggctgacatggccaaagcccatccaagtcctctcagcctccatatctaggatgagaag
ttgtcctgggcctgtgagtctcgctcacatttctgcataagtgtcaggcctggcatagat
gattcccttttgctttggtgctgctttgagcttgccccgttatcatttagtaaagtgcat

 2.03 PlyA -  15031  15026    6                               1.05
 2.02 Term -  17022  16824  199  2  1    7   32   273 0.270   9.49
 2.01 Init -  19327  19320    8  1  2  103   91     0 0.723   2.35
 2.00 Prom -  21172  21133   40                              -6.15

 3.01 Init +  36782  36814   33  1  0   81   68    25 0.040  -0.28
gtcaagggtggggccaggtggagataattgaatcacgggggcggtttcccccatactgtt
ctcctggtaatgaataaatctcatgagatccgctggttttataaatgggagttcccctgt
gcaagctctcttgcctgctgccatgtaagtcatggctttgttcctcatttgccgtccgcc
ATGATTGAGAGTCCTCCCCAGCCATATGGAATT
gtgagtccattaaacccctttcctttataaattacccagtctcagttatatctttattag
cagcctgagaacagactaatacagtccttctcccccaccatgttttggggtttatctgag
gataataattcctaataaatactttacttctttggcatttggacctctggacagcttttt

 3.02 Intr +  39689  39832  144  1  0   76   52    74 0.084   2.16
cagttgcatttagctgggcctgacatcatttgggatcttggctggactagaatgtccagg
gtaactcacttatctgctaccttcacagggacggcctcaaggctgaaatgactgggggcc
ctgggatggctggagactctctttctctccatattgtctcagggcctcttctccatgtag
GAAGGTAGCCAGATTCTTACATTGCAACTCGGGGTTTTGCAAGGCACAAAAGCAGAAGCT
GCTTCCAATGATATGGGTCCCAAACTGGCTTTGCATCACTTTATTCACATTCTGTTGGTT
AAAGTGATTCACCGACCAGCTCTG
gtacagggtagaagggggctacacaaggatttgagtattggaatgcactgaaggtcatca
tggagactaacccactgtaggaagcacattcatcgaaaacgtcatttccagtactgctta
tccatggataatgaggacctcctgtagctgtagtcactttggtgcatcgtttccaaaaac

 3.03 Intr +  48573  49052  480  2  0   91   98   311 0.523  24.70
ttagatctgcagtggggatagattctgaagtcggcaggattgtgagatcgtatctctagt
tttattgatttgccttcttacatgggtatatgttcacagcctcccaccccttacggacaa
gagtttatgtgtgtgttaaatattctgattgtagttgtttgtttgtttgtttgtttttag
AAAAAAGAAATCCTCTTTTTAGAACATCTCTTGGTGGTACCATCAGAAATGTCTTCCTTA
AGTGGAAAAGTCCAAACCGTTTTGGGCCTTGTAGAGCCAAGCAAACTGGGCCGTACCCTG
ACCCATGAACACCTGGCCATGACCTTTGACTGCTGTTACTGTCCACCTCCCCCGTGCCAG
GAAGCTATTTCCAAAGAACCTATCGTGATGAAAAATTTATATTGGATTCAGAAAAACGCC
TATTCCCATAAAGAAAACCTTCAATTAAATCAGGAGACAGAAGCCATAAAGGAAGAACTG
TTGTATTTTAAAGCTAATGGTGGAGGGGCTTTGGTGGAAAACACAACCACTGGGATTAGC
CGAGACACACAGACGTTGAAGAGGCTTGCAGAAGAGACTGGCGTCCATATCATATCTGGA
GCCGGGTTTTATGTGGATGCAACTCACTCCTCAGAGACCAGGGCCATGTCAGTGGAGCAG

gtaaaaagcctaagttctttgacagtatttgttcataaattcagaacagccagaaccttg
gaaatgccctgggttcagaggtagctgggcatgctacggaaatttgctagctagcaaaga
catctgccagttggggccccagttagtaacactgtatttcataaagaaagtgccaatttt

 3.04 Intr +  50588  50853  266  1  2   86   97   221 0.978  18.19
gttgatttttgatttggccagcaaaatgcctttttccttggccaatattaattgataaat
actgaatacatttttaaaagaatgaatgacaaaataaataaattcattcacatactgtgg
tggatctattttgataaatttcacaacctataaaatatattccttctcactcttccttag
CTTACCGATGTCCTTATGAATGAAATTCTCCATGGAGCTGATGGAACCAGTATCAAGTGT
GGCATTATTGGAGAAATTGGTTGCTCCTGGCCTTTGACTGAGAGTGAAAGAAAGGTTCTC
CAGGCCACAGCTCATGCCCAGGCTCAGCTTGGTTGTCCTGTTATTATCCATCCTGGACGG
AGCTCCAGGGCACCATTTCAGATTATCCGAATATTGCAAGAAGCAGGCGCAGACATCTCC
AAAACAGTCATGTCACACCTGGATAG
gtaagtaggctgtcttacaaatggatgcaaactgccatataattaatgcatgatcaaatt
aagaatctacagtaatcagtcaatgcaatactaatcacgcagagaaaaccactaactata
tggaaggtagtatttataaagtttcacaactgacatgaataaaagtcaatgctgccattt

 3.05 Intr +  60444  60567  124  0  1   52   17   111 0.358   0.07
tccttcactcttgctgctgtgctccgtaatctggctaataacagcgctatttacccagct
gttagcctaaagacctccagatacaagctctcctgtccactcctctggtgttctctgaat
tcagcccctcatttatcatttgaattattataagtctccaaacacaaatccctcccttag
TTTTGGTCCCAGATCTAGCCTCCACAATCCACCAGATCTTTCCAAAGGCAAATCTAATTA
TATCCCTGATCCTGACTTAAAAGCCTCCAATGGGTCACCTTTGCCTCAGGCACAAAATCC
GAAG
gtcttggtcttctggttccctcgcctccctccaccttatctctcgttattcccagtatgc
acacagtctctgagccaaagccacactgaccatgtctttgagtgccctgtattggttgtc
cttatatgcatctcacacatgctattctctctgctaggaatgttctatttccccttatct

 3.06 Intr +  62989  63209  221  0  2   31   65   156 0.813   3.78
actgtctcaaaaaactaaaataaaaaacaactctcaagaagtattcatggatatagaatg
cagaatgaggaaaactggctgaggttagcacctccactcttctaagatgtgctatgagat
cattggtgactgggagggacaggacctctgtttaatcctcatctgctggatggcacacag
AGTTCATTTTCCCATGGTAATATACTGACATTAGGGGTCAACCCTCTCCAAGTGAAAAAG
AAAGTCACTTGCATAAATGCAACTTCAGTAGCGCTTTGGCAGTCCCTGGAAGCCATCCAG
CTGAATGTCAATTTCACATGGGTAAGTCACCTTGTTAGACGTTCACGGCGCAAGGTGCTT
GTTCCTAGATGTCACTACGATGGTGAGTGTGTCTCCGTAGT
gtgagtgccttggaggaggaacggagttgccctggtgcctgggtgttcttacccctggag
gggcagcctggtttaagaacacggcctcaacacaaaagcagtttgggtttgtttgaagct
cttcaggttgagacctgagtttatcttttctgagacttaaagtcctcatctgtaagatgg

 3.07 Intr +  69256  69396  141  1  0  112   94   116 0.898  13.15
ctagtaacaaattgaacttactgttttatactcacatcattaagagccatttcagaagtg
tctgttactcgacttcaactatgttcttgttcttgtacattgtgtgcttaaaacttctag
tatgtacatgtggaaaatgggctcttcataataacagttcatctgtcgcattgtttctag
GACTATTCTTGATAAGAAAGAGCTCTTGGAGTTTGCTCAACTTGGCTGCTACTTGGAATA
TGATCTCTTTGGTACTGAACTACTTCATTACCAACTCGGCCCAGATATTGACATGCCTGA
TGATAACAAAAGAATTAGAAG
gtaaatatggtaaagcctctcatagcattccctttccctagccctttttgattgtcatat
ctagggaagtattagcaaagattcagaaaacagtaagcaggccgaaccacagacttgcag
agaaaaatatatctatgctgtttcagggagaaaaatctctctatattattttaaggagaa

 3.08 Term +  75282  75492  211  0  1   63   45   142 0.965   3.18
tgcagcaatatttttatcgtcaccacacaatatttattaaaggtctctcagtacacacgc
cacagtagaagtcagtatctttacgacaagcacaataggttaatgagtaaaaagttgaaa
gcatcctgaaaagcgaaaatgaaagacaaatgacatctaatgagttaacatttttcacag
GGTGCGTCTCCTGGTGGAAGAGGGCTGTGAAGATCGAATTCTGGTAGCACATGACATACA
TACGAAAACCCGGCTGATGAAATATGGAGGTCACGGCTATTCTCATATACTCACCAATGT
TGTTCCTAAAATGTTGCTGAGAGGCATAACTGAGAATGTGCTTGATAAGATTCTAATAGA
GAACCCTAAGCAATGGCTAACTTTCAAATAG
gatggttgcttatgaattcacaccttgagtataaaacttgcagagaacattcagcgattt
ccagtccactgtgagatattaatcagttacctaggactaatgacagatcatttccttctg
atgagaactaggagggtttgccttctctgagaccagctattacaactgtgcctctaggga

Predicted peptide sequence(s):


>PTER_1|GENSCAN_predicted_peptide_1|342_aa
XEGNAAPGQETVTSGNTKTKVLRMQHEDPEPTVTSNCQSTTSDLFLGKTKRATECSLVPD
CSMENWDLGKMQQFLSVWGSSPEFFSFSQTTDSQTAPAGGCGQAKTRGTAPDQGGAWQGF
EGRVLRRGRAWQGPTGRVLGLGEGVTSGQGRGENQRAKWEGTGETKKAREVGLPEVPREK
AARCTRGKASWSQSRSRNCGPSRKSGARRRRPRGQGSLQSSTRGSCRKEGFSSRCAWALP
PLLKCLRDVAKSASPVWRQLPVARQQCPGASSEPISHGTNPVNTETYKEATCLRCTDAPC
VASAFCPMSSLKTFPAVVGRILQADTKEAMLSPGWSSEDTAS

>PTER_1|GENSCAN_predicted_peptide_2|68_aa
MPRARHCLKIITIIINEEEVEVEEEEEEEKEGEGEGEGESSSAAAAGEEEEEEGGGGGEK
TKSHSWAQ

>PTER_1|GENSCAN_predicted_peptide_3|539_aa
MIESPPQPYGIEGSQILTLQLGVLQGTKAEAASNDMGPKLALHHFIHILLVKVIHRPALK
KEILFLEHLLVVPSEMSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQE
AISKEPIVMKNLYWIQKNAYSHKENLQLNQETEAIKEELLYFKANGGGALVENTTTGISR
DTQTLKRLAEETGVHIISGAGFYVDATHSSETRAMSVEQLTDVLMNEILHGADGTSIKCG
IIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPFQIIRILQEAGADISK
TVMSHLDSFGPRSSLHNPPDLSKGKSNYIPDPDLKASNGSPLPQAQNPKSSFSHGNILTL
GVNPLQVKKKVTCINATSVALWQSLEAIQLNVNFTWVSHLVRRSRRKVLVPRCHYDGECV
SVVTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRRVRLLVEEGCE
DRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK