GENSCAN 1.0	Date run: 14-Jan-104	Time: 22:03:11

Sequence PPP1R3C_1 : 6981 bp : 42.83% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Term +   3358   4297  940  1  1  106   38   703 0.546  57.68
ggtagacatagaagatctgatcacttaatactgttctcttttactacatatgatagcacc
tgcctgatatctagtgcactggctataattcagtcagcacaaaaatagtacatatgtatt
tggcactggggaagagcatttccgatccaggtgataatccctcttctttttgcattccag
AATGATCCAGGTTTTAGATCCACGTCCTTTGACAAGTTCGGTCATGCCCGTGGATGTGGC
CATGAGGCTTTGCTTGGCACATTCACCACCTGTGAAGAGTTTCCTGGGCCCGTACGATGA
ATTTCAACGACGACATTTTGTGAATAAATTAAAGCCCCTGAAATCATGTCTCAATATAAA
ACACAAAGCCAAATCACAGAATGACTGGAAGTGCTCACACAACCAAGCCAAGAAGCGCGT
TGTGTTTGCTGACTCCAAGGGCCTCTCTCTCACTGCGATCCATGTCTTCTCCGACCTCCC
AGAAGAACCAGCGTGGGATCTGCAGTTTGATCTCTTGGACCTTAATGATATCTCCTCTGC
CTTAAAACACCACGAGGAGAAAAACTTGATTTTAGATTTCCCTCAGCCTTCAACCGATTA
CTTAAGTTTCCGGAGCCACTTTCAGAAGAACTTTGTCTGTCTGGAGAACTGCTCGTTGCA
AGAGCGAACAGTGACAGGGACTGTTAAAGTCAAAAATGTGAGTTTTGAGAAGAAAGTTCA
GATCCGTATCACTTTCGATTCTTGGAAAAACTACACTGACGTAGACTGTGTCTATATGAA
AAATGTGTATGGTGGCACAGATAGTGATACCTTCTCATTTGCCATTGACTTACCCCCTGT
CATTCCAACTGAGCAGAAAATTGAGTTCTGCATTTCTTACCATGCTAATGGGCAAGTCTT
TTGGGACAACAATGATGGTCAGAATTATAGAATTGTTCATGTTCAATGGAAGCCTGATGG
GGTGCAGACACAGATGGCACCCCAGGACTGTGCATTCCACCAGACGTCTCCTAAGACAGA
GTTAGAGTCAACAATCTTTGGCAGTCCGAGGCTGGCTAGTGGGCTCTTCCCAGAGTGGCA
GAGCTGGGGGAGAATGGAGAACTTGGCCTCTTATCGATGA
attaagcaacaatgtaactggtcttgacttgtcatattcccccatgcaatcctaggtctg
tattgctcaattttaggaagcctttgctactccatcagtaggtttagatttgagcttttg
agacctggctatggaaaagaaagacacttgagaatttagtgttggggtctgtacagatga

 2.02 PlyA -   5340   5335    6                              -0.45
 2.01 Sngl -   6280   6098  183  1  0   47   42   205 0.605   6.60

Predicted peptide sequence(s):


>PPP1R3C_1|GENSCAN_predicted_peptide_1|313_aa
XMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNI
KHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISS
ALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSFEKKV
QIRITFDSWKNYTDVDCVYMKNVYGGTDSDTFSFAIDLPPVIPTEQKIEFCISYHANGQV
FWDNNDGQNYRIVHVQWKPDGVQTQMAPQDCAFHQTSPKTELESTIFGSPRLASGLFPEW
QSWGRMENLASYR

>PPP1R3C_1|GENSCAN_predicted_peptide_2|60_aa
MDLLPLTPRSSAAPFSPGLAPTAPSLCPSVQLEVLPVQERAVAQDVAATPTFPTPTPSPF