GENSCAN 1.0	Date run: 14-Jan-104	Time: 23:19:34

Sequence PHYH_1 : 24701 bp : 45.88% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   5696   5806  111  2  0  118   17    50 0.090   0.39
aaccagtattttttgtagagacagggtttcatcatgttgcctgggctagtctcaaactcc
tgacctcaagtgatccacttgcctcggcccgctaaagtgctagtattagaggtgtgagcc
attgtgcctagcctgtaatttaaaaatgtaacttattttgggattctttttctcctttag
GTATACTCTGGATAATAACGTTCTAACCCTGGAACAGAGAAAATTTTATGAAGAAAATGG
GTTTCTAGTAATCAAAAATCTTGTACCTGATGCCGATATTCAACGCTTTCG
gtacagtaacactatttgttattttacaatagtatgtattgtgtgcatgtaatgagaata
caaggtggattcgctcctggctttacagatgttttttaatgatttggtttgttgggaagt
gtttagaagcatgggctctggtgccagactggctttttattttttatagagaaaggttct

 1.02 Intr +   6706   6874  169  1  1   56   55   139 0.143   7.35
ggaatggattctagccagacagtttctcctccctttcattggaattattctacctcaagc
tggaggccaacttagtgcagagaaaccacccctcaagtctgcaaccctttccacagagga
gggcagggcaggtgcttggagccagcggtaacgacatcatttgcaaattaaattttctag
GAATGAGTTTGAAAAAATCTGCAGAAAGGAGGTGAAACCATTAGGATTAACAGTAATGAG
AGATGTGACCATTTCGAAATCCGAATATGCTCCAAGTGAGAAGATGATCACGAAGGTCCA
GGATTTCCAGGAAGATAAGGAGCTCTTCAGATACTGCACTCTCCCCGAG
gtcagagaccacccttgctttgcgtcggcttaattgccagtgtgtatgtctgcctgtaaa
acccgctgatttggccgggcgcagtggctcactcctgtaatccgagcactgtgggaggct
gaggcaggtggatcgcttgatcccaggaaccactgctcttagagctggatatggaaagga

 1.03 Intr +   9390   9477   88  2  1   84   59    21 0.223  -1.66
ttagaatgatttccaatggctgggtttttcatgctttgtttgcaatgttgtgaaataccg
cttggttcttaaactattgccttcttggttcttgtgtggatagctactgtactttgtacc
agttgtcaatacttctgatttcccacaaggtttgtttttgttttttttttgctttcttag
ATTCTGAAATATGTGGAGTGCTTCACTGGACCTAATATTATGGCCATGCACACAATGTTG
ATAAACAAACCTCCAGATTCTGGTAATT
gtaagggagaagaaaaaaaaatggtttcattaaaatgtgtaaggttggctgggtgcagta
actcatgcctgtaatcccagcattttaggagaccaagggaggaagatctctgaggccagg
agtttgagagtggcctgggcaacatagtgaggctctgtctctaaaaataaaatttaaaaa

 1.04 Intr +  12761  12942  182  0  2   59   92   166 0.483  13.69
ctgtagaaacggagtctcactgtgtttcccgggatggttttgaactcccaggctcaagcc
atccatctgcctcagcctcccactttgggatatatttttatatcccaaagtgctggggtt
acaggcgtgagccactgcactcggcctcgagtatcctttagtagcaggttttcttttcag
GCAAGAAGACGTCCCGTCACCCCCTGCACCAGGACCTGCACTATTTCCCCTTCAGGCCCA
GCGATCTCATCGTTTGCGCCTGGACGGCGATGGAGCACATCAGCCGGAACAACGGCTGTC
TGGTTGTGCTCCCAGGCACACACAAGGGCTCCCTGAAGCCCCACGATTACCCCAAGTGGG
AG
gtaggtctgcccggcggctgagtcttgatccgaatctccttcgcagtttctgtttcacat
cagtacctctaaagagtttacaaatgagatggcatttcctttctgagcaaaacattgtcc
taagatttgcagtgaggatcagagaaagttcaaggatgtcagagaaaacattcatcacac

 1.05 Intr +  17463  17612  150  2  0   82  121   187 0.997  21.76
agatatctgagaggcttttgtatactgaaaaaaatgtaagcatttaatttagacatttat
ttctcttgggagagagaaatgctttctttccctgatgtttgctttccctgatgaaccatt
gacaatgtttttaattatggtactccctcaaatgtagacttcacttgcctcttgttctag
GGGGGAGTTAACAAAATGTTCCACGGGATCCAGGACTACGAGGAAAACAAGGCCCGGGTG
CACCTGGTGATGGAGAAGGGCGACACTGTTTTCTTCCATCCTTTGCTCATCCACGGATCT
GGTCAGAATAAAACCCAGGGATTCCGGAAG
gtaagcattcacattgctgcacctgctgcagaagtgtgggttagaaacaaaaattgtatt
caattcattgaattcaaattaattgaataaaattttaattaaattgcattaacattttaa
agatttgtggcttttaaccaacctggactttagtccagtttatttaccaggaaatatatt

 1.06 Intr +  20192  20326  135  1  0   55   95   181 0.968  16.26
ctggaaacaaaaacaggcttagttacaaagagattgacacaggatgcaatggacctgact
ttccacttagaaatcaaatactgagtgaaataaatgactttctaaaagaaagactccctg
cttggtcactggtattcatgggatgtttttctccaatatcaatttgttcactttgcacag
GCAATTTCCTGCCATTTCGCCAGTGCCGATTGCCACTACATTGACGTGAAGGGCACCAGT
CAAGAAAACATCGAGAAGGAAGTTGTAGGAATAGCACATAAATTCTTTGGAGCTGAAAAT
AGCGTGAACTTGAAG
gtatgtttgtatacaatagcaaggtaaaaatctcaggtttttcttttcttcagatgcttc
ataattctcatacctagtttatttgacagtatatagtgcttgggtttagattcattttag
ggacatcgctgagcccccaccaaaaatgacaatggaatttccatttacacttgtgccccc

 1.07 Term +  22948  23001   54  0  0   85   44    53 0.799  -1.84
gagtaagtagtttaagttgagttgttttgtttactaatgaatataacttacagggattat
tttccctatgtaacctttcatagaagctagaaatcaattttgtgttatggtgaaattgaa
ggttaatggagggcagattgaagtgttccataaacccactctgtttgatattatttccag
GATATTTGGATGTTTCGAGCTCGACTTGTGAAAGGAGAAAGAACCAATCTTTGA
aatagccatctgctataactctttcaacagaaaaccaaaaccaaacgaaatgtctaagga
aaatgttttcttaatgagatgatgtaaccttttctatcacttgttaaaagcagaaaacat
gtatcaggtacttaattgcatagagttagttttgcagcacaatggtgttgctttaatgga

Predicted peptide sequence(s):


>PHYH_1|GENSCAN_predicted_peptide_1|296_aa
XYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDV
TISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPD
SGNCKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDY
PKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHF
ASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL