GENSCAN 1.0	Date run: 14-Jan-104	Time: 21:59:30

Sequence PAPSS2_1 : 88558 bp : 40.60% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.02 Intr -    627    102  526  0  1   55   78   157 0.242   2.99
 1.01 Init -   1283   1158  126  2  0   89   60   311 0.579  28.61
 1.00 Prom -  15786  15747   40                              -6.25

 2.01 Init +  31556  31615   60  1  0   60   93    57 0.150   4.70
tagtaatccacgtctagcaattaatcccacagatatattttcacatgcaaaaaattaagt
ataaggttattaattattgcaatgtttgtaataataaaagactggaaatcatccaagtat
tcatcaaaaaagagctagttaaatatatattcatacaccggaacattatgcaagggtaaa
ATGAATGAGAAAACCCTCTGTACTGATGTGGAAAGATTTGCCAAGACAGATCTGAAAAAG

gtgtgtaatagtgtggaaaggaggattaagcaaataaatgcctattttaaaatttatgca
taaaaaactgacagagcatgtaaggaacgaatagaaatgaccatctacttttagaagtga
ggaggagggaggctagagagatgggggcggaggcagaagtggcagcatggcttctgcata

 2.02 Intr +  50496  50613  118  2  1  100   91    26 0.870   3.22
agaaatgaaaaaaactatattagaatggacaaaggtgagtctctttcaaaatatttttta
tataagttgttacatgtatcagtttcgcaattaaaagtttaagatggatttatattggct
ccagtgaagaatatgtgttttattaattaatactgtgcttggttttgtcttattttatag
GAGAACCAGCAGAAATCCACCAATGTAGTCTATCAGGCCCACCATGTGAGCAGGAATAAG
AGAGGGCAAGTGGTTGGAACAAGGGGTGGGTTCCGAGGATGTACCGTGTGGCTAACAG
gtatgtcatgttcatatatatatatatatatacaaattgcaaactgacatgtgacacaat
tttatggaaattagtgtaacgtattacatgcttgttttatcattagaaggaggctgggag
atgtagtagaaagcctgggtgttagtcctaaccctaccatcagtgagaaatagagtcaag

 2.03 Intr +  54375  54610  236  1  2   83   93   157 0.901  12.18
tagttatttcaaaatttgagagaaatgtaagtacttgccttgtagtcaactacactgatt
tctttctttcttttttttttttttaagatttagttatatttaaaattactagattagttc
acaatttgtcatcttaaactatccaggccgatgtcagtctgttttatctgttctgaacag
GTCTCTCTGGTGCTGGAAAAACAACGATAAGTTTTGCCCTGGAGGAGTACCTTGTCTCCC
ATGCCATCCCTTGTTACTCCCTGGATGGGGACAATGTCCGTCATGGCCTTAACAGAAATC
TCGGATTCTCTCCTGGGGACAGAGAGGAAAATATCCGCCGGATTGCTGAGGTGGCTAAGC
TGTTTGCTGATGCTGGTCTGGTCTGCATTACCAGCTTTATTTCTCCATTCGCAAAG
gtaaaaaaaaaaaaaaaaaaaaaaggcactacacacgattcccacacacagtgcaagtgc
tctccaactgctaggggaaggaatcggagagggagggcataagaatgtctcctttcaatt
tcccgactatttcttcccccaataacaggctctctcatttcctctatttaatattggtta

 2.04 Intr +  55344  55482  139  2  1   83  116    86 0.999  10.02
aagtccttgagagagctgtgtttaccagagtaaaatttctggactttctctcaagcactc
tgcaaagcacaaaccccagtgttatctcaaggctattgaaaaccaaagtacacagtgttt
tgtgatttagaatttcaccgtgaaacctctttttacattcttaatcatattgcttttcag
GATCGTGAGAATGCCCGCAAAATACATGAATCAGCAGGGCTGCCATTCTTTGAAATATTT
GTAGATGCACCTCTAAATATTTGTGAAAGCAGAGACGTAAAAGGCCTCTATAAAAGGGCC
AGAGCTGGGGAGATTAAAG
gtaagagaattggctagtagcgtctaccagttacataggctgtcagtcctcagtccttat
tctgtcctcagaaatcttccttgagtttcaaactgttttccaaaattgcatataacatgc
acaactttttatcagatcatgatatattcagtatgcccagaggcttattaaaaggtaggg

 2.05 Intr +  56045  56163  119  0  2   98   96   153 0.994  16.36
gaaaatacagctatatattttcttacttatggctagaagtcaaggatggctgtttgacct
tttctgttaaagtgtgaattttcagtttaatacattattccaacatgtgttttgccttat
tgattaaaaagattattctgtcaatacagatgcgatgattgtcacccatatgctttgcag
GATTTACAGGTATTGATTCTGATTATGAGAAACCTGAAACTCCTGAGCGTGTGCTTAAAA
CCAATTTGTCCACAGTGAGTGACTGTGTCCACCAGGTAGTGGAACTTCTGCAAGAGCAG
gtaggtgaaccggttgtctttttttatatgtttaataaaatcatgaaagacaatctatgc
ctctttactgaagcattctttttacagttttcaagtttttaccaatgctgtttcatttca
gaacattgtaccctatactataatcaaagatatccacgaactctttgtgccggaaaacaa

 2.06 Intr +  56285  56398  114  1  0   81  115    61 0.987   7.82
ccaatttgtccacagtgagtgactgtgtccaccaggtagtggaacttctgcaagagcagg
taggtgaaccggttgtctttttttatatgtttaataaaatcatgaaagacaatctatgcc
tctttactgaagcattctttttacagttttcaagtttttaccaatgctgtttcatttcag
AACATTGTACCCTATACTATAATCAAAGATATCCACGAACTCTTTGTGCCGGAAAACAAA
CTTGACCACGTCCGAGCTGAGGCTGAAACTCTCCCTTCATTATCAATTACTAAG
gtaagtgggtgcagactggtcaaataattaggcttaatatcagtcattataatttattta
caattactcttaacaataagaaaagtataaataaggtgcacataatgtccataaataaaa
cactcctttttttccaagttatttttaacctcttctccaaagaaatctctcaccaagaat

 2.07 Intr +  57032  57143  112  1  1  103   80    87 0.990   8.43
tccaaacttaaatatttctggcccttagatcatgggttagcataacaggtggggacactt
aaaacatagaaggttctgccctcatcctcctgttaactgaataagaaaggacttccctgg
ggccagatgcctggaaaacagaacttatgaaaatgttcaactactttttgtgttttgcag
CTGGATCTCCAGTGGGTCCAGGTTTTGAGCGAAGGCTGGGCCACTCCCCTCAAAGGTTTC
ATGCGGGAGAAGGAGTACTTACAGGTTATGCACTTTGACACCCTGCTAGATG
gtatgtttttgttgttgtttcttactctttgttgttaaggaaaaaaaaaaatctttccca
gaagttttgcaggaacaggaagttagtctttagtttgcaaatcttattgcaaaactgttt
ggatcatttacagtgtgctccattctattatgtttaagcttccatttttaggattttttg

 2.08 Intr +  68584  68789  206  2  2   66  106    97 0.071   7.30
tcaaggacttgtcattatagaatctagagaaactggtgcagctaacacaactacttggat
ttgggtcttaatgcttcttgaaggaaatgtttggaaggggcattgtgcacatttgattca
tgcttcaaggatggcacaccttatatctagttttcgtgcatcacatggctctttccacag
ATGGCGTGATCAACATGAGCATCCCCATTGTACTGCCCGTCTCTGCAGAGGATAAGACAC
GGCTGGAAGGGTGCAGCAAGTTTGTCCTGGCACATGGTGGACGGAGGGTAGCTATCTTAC
GAGACGCTGAATTCTATGAACACAGAAAAGAGGAACGCTGTTCCCGTGTTTGGGGGACAA
CATGTACAAAACACCCCCATATCAAA
gtaagtcacaaaacctttggaaggactttcttgagctatttaaactgagaagaaaaataa
ctctttttaattcctttgcaaaggacttagaaaaactgggattaggtggaagaatgtatt
tctaaggtagtgtttgcaggctttgcctcaggagatgtttttagaaaggtgcaaagaaat

 2.09 Intr +  72041  72280  240  1  0   12   45   189 0.223   3.82
tgtagattttctcttcaaatgcaaatgtaccccacaaaaggcagatttttagctattttt
gtattttccagcccttttgaatagccatcttgaactatgtcaaagaaatatattttgggg
taaaatattttggtttccttaacagatatggagaaggtttgagtggtcttgtccaaccag
CTACAACATTGCCTTAAGCCAAAACACCTAATTCAGAGCAAAGCCCTAACTCCCTTCAAT
TCTATGAAGGTTGAGAGAGGTGAGAAAGCTGCAGAAGAAAAGTTGGAAGCTAGCAGAGGT
TGGTTCAAGGGGTTTAAGGAAAAAAGCCATCTCCATAACATAAAAGTACAAGGTGATGCA
GCAAGTGCTGATGTAGGAGCTGCAGCAAGTTACCCAGAAGATCTAGCTAAGATCATTGAT

gtaggtggctacactaacaacagattttcagtgtagaagaaacagccttctattggaaga
agatgccacctaggattttcagagctaaagaagagaagtcaatgcctggcttcaaagctt
caaaggacaggctaactctcctgttaggagctagtatagctggtgactttaagttgaagc

 2.10 Intr +  82535  82670  136  1  1   62   84   157 0.238  11.92
tttttaagagcataacgggttctagagaccaaaaagtttgagaaatactgtgccagaaat
actaaagaactgaaggcagttctttaactgtaacccgagattggtctaaaaggagaaaac
ttttcagataaaatagaaatcacaattaatcattagcaatcataacaatgttctttctag
ATGGTGATGGAAAGTGGGGACTGGCTGGTTGGTGGAGACCTTCAGGTGCTGGAGAAAATA
AGATGGAATGATGGGCTGGACCAATACCGTCTGACACCTCTGGAGCTCAAACAGAAATGT
AAAGAAATGAATGCTG
gtatgtaaactgttcttagtgcattttatttatttatttattgagatggtgtcttgttct
gtcacccaggctggagtgcaatggcacgatctcagctcactgcaacctctgcctcccagg
ttcaagtaattctcctgcctcagcctcctgagtagcttggattacaggtgcccaccacta

 2.11 Intr +  84673  84941  269  2  2  120   83   310 0.996  30.03
ctgagatcgctgactgcactccagcctgggcaacagagtgagactctttcaaaaaaaaaa
aaaaaagccagtggataatgaatgcacagaacaataaacatagctgtgtcctttctgttc
ttgtggagaaatgacaccatgtgtttctgtgaccttccttcttctgctttcctctcccag
ATGCGGTGTTTGCATTCCAGTTGCGCAATCCTGTCCACAATGGCCATGCCCTGTTGATGC
AGGACACTCGCCGCAGGCTCCTAGAGAGGGGCTACAAGCACCCGGTCCTCCTACTACACC
CTCTGGGCGGCTGGACCAAGGATGACGATGTGCCTCTAGACTGGCGGATGAAGCAGCACG
CGGCTGTGCTCGAGGAAGGGGTCCTGGATCCCAAGTCAACCATTGTTGCCATCTTTCCGT
CTCCCATGTTATATGCTGGCCCCACAGAG
gtgagcaattcccagagctgggctttgagactcaggaattcagactcagactttacatag
aagagtaaatgagtctctgggatcctttctgtttcctcatgagcagattctggaatgttc
tggtgtctcttctttatctagcttaattatgtttccacttagtatttgaaaagtgctaga

 2.12 Intr +  86302  86531  230  0  2   63  100   221 0.948  16.54
acctaatataacaaagcatgaagagtgcacggagtcttagaacctcagtgattttcttgc
aattcttagttgactcacattgctgaattacttttaaagtagaataaaggtgtctccata
aaccatgacctacagatttgacccacaatgaccagcatgtcccttatggacattttctag
GTCCAGTGGCACTGCAGGTCCCGGATGATTGCGGGTGCCAATTTCTACATTGTGGGGAGG
GACCCTGCAGGAATGCCCCATCCTGAAACCAAGAAGGATCTGTATGAACCCACTCATGGG
GGCAAGGTCTTGAGCATGGCCCCTGGCCTCACCTCTGTGGAAATCATTCCATTCCGAGTG
GCTGCCTACAACAAAGCCAAAAAAGCCATGGACTTCTATGATCCAGCAAG
gtaggttttcagaggaaaattcttttatcaacatctgtataaaagaaatgatgaggcaga
atttgggccctttgaaaaactctccagtgcattgccacatgctcccaagtggactgagtc
ccttgagagtcaagacgtggtcttataaattttatgtcccctaaaattgtactacagtct

 2.13 Term +  87132  87270  139  0  1   71   46   125 0.965   3.05
tagctgccattatttcccttctcttctgcaagttcctgaagatttagaggactgcccact
tttgaagatgcagcattttacagaaagaacatgggtctcaaaaaccataacctactccag
gaatccttaaggcagatatcatttacctacactgagttctttgttgccaccctgtaacag
GCACAATGAGTTTGACTTCATCTCAGGAACTCGAATGAGGAAGCTCGCCCGGGAAGGAGA
GAATCCCCCAGATGGCTTCATGGCCCCCAAAGCATGGAAGGTCCTGACAGATTATTACAG
GTCCCTGGAGAAGAACTAA
gcctttggctccagagtttctttctgaagtgctctttgattaccttttctatttttatga
ttagatgctttgtattaaattgcttctcaatgatgcattttaatcttttataatgaagta
aaagttgtgtctataattaaaaaaaaatatatatatatacacacacacatatacatacaa

 3.02 PlyA -  87722  87717    6                              -0.45
 3.01 Term -  88106  88006  101  0  2   75   45   140 0.903   5.71

Predicted peptide sequence(s):


>PAPSS2_1|GENSCAN_predicted_peptide_1|218_aa
MLAGCGGARVPGAETEGRRDGGGGGGSSSSSSSSGCRTPGKEQVLLSSSFTNEQLRLSDF
AKIIFQMRGFKPRLTASSVQAFFTSIITHGDNSQGSQLVCSLCIVLRGFHALPPFPLTTV
SSGYRYGPVEARPLLTTTSKWQWPMEAQQLVSVHPQSSTSVPLEWALRRRKRRHKMSRLR
PRAPRFYQKAVWGNPLNEPKGSMGQPSERTQMSRPSRX

>PAPSS2_1|GENSCAN_predicted_peptide_2|705_aa
MNEKTLCTDVERFAKTDLKKENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTG
LSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKL
FADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARA
GEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIHELFV
PENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDD
GVINMSIPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTT
CTKHPHIKLQHCLKPKHLIQSKALTPFNSMKVERGEKAAEEKLEASRGWFKGFKEKSHLH
NIKVQGDAASADVGAAASYPEDLAKIIDMVMESGDWLVGGDLQVLEKIRWNDGLDQYRLT
PLELKQKCKEMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTK
DDDVPLDWRMKQHAAVLEEGVLDPKSTIVAIFPSPMLYAGPTEVQWHCRSRMIAGANFYI
VGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPAR
HNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN

>PAPSS2_1|GENSCAN_predicted_peptide_3|33_aa
XGAAAASGPSFLQDTMTTAKSGKDNFPRHRHIV